Identifiers and Description

Gene Model Identifier

TTHERM_00551160

Standard Name

TDH1 (glyceraldehyde-3-phosphate dehydrogenase 1)

Aliases

PreTt29220 | 72.m00143 | GapC

Description

Glyceraldehyde-3-phosphate dehydrogenase; metabolic enzyme involved in glycoloysis

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF04641 ) Protein of unknown function, DUF602
  • ( PF04725 ) Photosystem II 10 kDa polypeptide
  • ( TIGR01532 ) D-erythrose-4-phosphate dehydrogenase
  • ( TIGR01534 ) glyceraldehyde-3-phosphate dehydrogenase, type I
  • ( PF02800 ) Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
  • ( PF00044 ) Glyceraldehyde 3-phosphate dehydrogenase, NAD binding

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 23.6%

TetraMine Data

TTHERM_00551160

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07327.19.997093137033517e-262glyceraldehyde-3-phosphate deh
ydrogenase, type I family prot
ein (343 aa)
OxytrichaContig18741.0.g631.999126889527329e-167Glyceraldehyde 3-phosphate deh
ydrogenase, C-terminal domain
DictyBaseDDB_G02751532.0007442334946695e-153gpdA on chromosome: 2 position
5324765 to 5325948
WormBaseWBGene000016862.0003615238957836e-139locus:gpd-4 Glyceraldehyde-3
-phosphate dehydrogenase 4 s
tatus:Confirmed UniProt:P173
31 protein_id:CAA88697.1
SGDYJL052W2.998636664422997e-137TDH1 Glyceraldehyde-3-phosphat
e dehydrogenase, isozyme 1, in
volved in glycolysis and gluco
neogenesis; tetramer that cata
lyzes the reaction of glyceral
dehyde-3-phosphate to 1,3 bis-
phosphoglycerate; detected in
the cytoplasm and cell wall
Stentor CoeruleusSteCoe_241641.1983630608508849e-70

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:11230543: Fast NM, et al. (2001) Nuclear-encoded, plastid-targeted genes suggest a single common origin for apicomplexan and dinoflagellate plastids. Mol Biol Evol 18(3):418-26
  2. Ref:9734334: Hafid N, Valverde F, Villalobo E, Elkebbaj MS, Torres A, Soukri A, Serrano A (1998) Glyceraldehyde-3-phosphate dehydrogenase from Tetrahymena pyriformis: enzyme purification and characterization of a gapC gene with primitive eukaryotic features. Comparative biochemistry and physiology. Part B, Biochemistry & molecular biology 119(3):493-503
  3. Ref:9304812: Zhao Y, Nakashima S, Andoh M, Nozawa Y (1997) Cloning and sequencing of a cDNA encoding glyceraldehyde-3-phosphate dehydrogenase from Tetrahymena thermophila: growth-associated changes in its mRNA expression. The Journal of eukaryotic microbiology 44(5):435-7

Sequences

>TTHERM_00551160(protein)
MALRLGINGFGRIGRLVLRAAVENHANEVKVVAINDPFMDVDYLIYQLKYDSAHLKFPGK
IEKVDDHTIKVNGNNITLFKEKDPAALKWGDAGADFVCESTGAFLTQEKAAAHLKGGAKK
VILSAPAKDDTPTFVFGVNHKNYNPSQNIISNASCTTNCLAPVAKVLHEKFGIAEGLMTT
VHASTATQLVVDGPSKGGKDWRAGRAASTNIIPSSTGAAKAVGLVLPALKGKLTGMSFRV
PTINVSVVDLTVRLEKGTTYANICEAMKEASEGELKGILGYTKEEVVSQDFMHDARTSIF
DHKAGIGLNDNFHKIISWYDNEWGYSNKLIDLALHVKKTSGL


>TTHERM_00551160(coding)
ATGGCTTTGAGATTAGGTATTAACGGTTTTGGTAGAATCGGTAGATTAGTATTAAGAGCT
GCTGTTGAAAACCACGCCAACGAAGTCAAGGTTGTTGCTATCAACGATCCCTTCATGGAT
GTCGACTACCTCATTTACTAATTGAAGTACGACTCTGCTCACCTTAAGTTCCCTGGTAAA
ATCGAAAAGGTTGACGACCACACCATCAAGGTCAACGGTAACAACATCACCTTGTTCAAG
GAAAAGGATCCCGCTGCTTTAAAGTGGGGTGATGCTGGTGCTGATTTCGTTTGCGAATCC
ACTGGTGCTTTCCTTACCTAAGAAAAGGCTGCTGCTCACTTGAAGGGTGGTGCTAAGAAG
GTCATTCTCTCTGCCCCTGCTAAGGATGACACTCCTACCTTCGTCTTCGGTGTTAACCAC
AAGAACTACAACCCCTCCTAAAACATTATTTCCAACGCTTCTTGCACTACCAACTGTCTT
GCTCCCGTTGCTAAGGTCCTCCACGAAAAGTTCGGAATTGCTGAAGGTCTCATGACCACT
GTCCACGCCTCCACTGCTACCTAATTGGTTGTTGATGGTCCCTCCAAGGGTGGTAAGGAC
TGGAGAGCTGGTAGAGCTGCCTCAACCAACATCATTCCTTCTTCCACTGGTGCTGCTAAG
GCTGTCGGTCTAGTTCTCCCTGCCTTGAAGGGTAAGTTGACTGGTATGTCCTTCAGAGTT
CCTACCATTAACGTCTCTGTCGTTGATCTTACCGTCAGACTCGAAAAGGGTACCACCTAT
GCTAACATTTGTGAAGCCATGAAGGAAGCCTCCGAAGGTGAACTCAAGGGTATCTTGGGT
TACACCAAGGAAGAAGTCGTCTCTCAAGACTTCATGCATGATGCCAGAACCTCCATCTTC
GATCACAAGGCTGGTATTGGTTTGAATGATAACTTCCACAAGATCATTTCTTGGTATGAT
AACGAATGGGGTTACTCTAATAAGTTAATTGACCTCGCTCTTCACGTCAAGAAGACCTCT
GGACTCTGA


>TTHERM_00551160(gene)
ATGGCTTTGAGATTAGGTATTAACGGTTTTGGTAGAATCGGTAGATTAGTATTAAGAGCT
GCTGTTGAAAACCACGCCAACGAAGTCAAGGTTGTTGCTATCAACGATCCCTTCATGGAT
GTCGACTACCTCATTTACTAATTGAAGTACGACTCTGCTCACCTTAAGTTCCCTGGTAAA
ATCGAAAAGGTAATTAACTAATTAATTTATTAACTAACTATTTAACTCATTATTTGGTTA
TGTATTTTCGTTCAAACTCTACTTATATACCTTCAAACCTCTTTCACTAATACCCATCAA
ATAAGCAAATATCTTTTTTCCAACACTGCTCTTGTTATAGGAAATATGGTAGTTATACGA
CACCACTATTTCTTTAGTCATTTTGACCTTTTTCTTTTGAGTAGGATTCAATCTCATTAT
GAATGATGAGTTTCATTTCTCATTTTTGAACATATAATATTCTAATATTCTACTCAACCC
ATTTAAAGAGAGAGAGAGAGGAAGATATAAACGAAAAACAAACAAAGAGGAATTCATGAA
ATATCATTTACTAATACTTATTTATTTATAAATAAAGGTTGACGACCACACCATCAAGGT
CAACGGTAACAACATCACCTTGTTCAAGGAAAAGGATCCCGCTGCTTTAAAGTGGGGTGA
TGCTGGTGCTGATTTCGTTTGCGAATCCACTGGTGCTTTCCTTACCTAAGAAAAGGCTGC
TGCTCACTTGAAGGGTGGTGCTAAGAAGGTCATTCTCTCTGCCCCTGCTAAGGATGACAC
TCCTACCTTCGTCTTCGGTGTTAACCACAAGAACTACAACCCCTCCTAAAACATTATTTC
CAACGCTTCTTGCACTACCAACTGTCTTGCTCCCGTTGCTAAGGTCCTCCACGAAAAGTT
CGGAATTGCTGAAGGTCTCATGACCACTGTCCACGCCTCCACTGCTACCTAATTGGTTGT
TGATGGTCCCTCCAAGGGTGGTAAGGACTGGAGAGCTGGTAGAGCTGCCTCAACCAACAT
CATTCCTTCTTCCACTGGTGCTGCTAAGGCTGTCGGTCTAGTTCTCCCTGCCTTGAAGGG
TAAGTTGACTGGTATGTCCTTCAGAGTTCCTACCATTAACGTCTCTGTCGTTGATCTTAC
CGTCAGACTCGAAAAGGGTACCACCTATGCTAACATTTGTGAAGCCATGAAGGAAGCCTC
CGAAGGTGAACTCAAGGTAATTATTAATTCCCTTTAAAAATGCTAATTATTAAACTTAAA
GAGAATAAATACTACATAAATAAGGATAAATGCTAACAAAAAGGGCCGAAATATACTTAA
TTGTATAGCTCAGGCTTTCTATTTTATTGATAAAAAAAAAAATATAGGCATTTAACAAAG
ATAACATATTATCTTTTAATTTAAAGCTAAAGCTTTTCAAATACATTTTAAATAAAAAGC
AATGCTCATTCTTTTTAAAAATATTAATGAGTTAATTAAAAAGCTATAAATTAAATTAAG
AGATTCTATTTTTTTATTTTTTTGTTTTTTACTTTTATTAATTCATATATTCATTCGTTT
TTAACTCATTATTTTCTAATTATAGGGTATCTTGGGTTACACCAAGGAAGAAGTCGTCTC
TCAAGACTTCATGCATGATGCCAGAACCTCCATCTTCGATCACAAGGCTGGTATTGGTTT
GAATGATAACTTCCACAAGATCATTTCTTGGTATGATAACGAATGGGGTTACTCTAATAA
GTTAATTGACCTCGCTCTTCACGTCAAGAAGACCTCTGGACTCTGA