Identifiers and Description

Gene Model Identifier

TTHERM_00600840

Standard Name

TCXL1 (TCX-Like)

Aliases

PreTt22147 | 83.m00216 | 3685.m00108

Description

TCX homolog; Tesmin/TSO1-like CXC domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF05033 ) Pre-SET motif
  • ( PF03638 ) Tesmin/TSO1-like CXC domain
  • ( TIGR01918 ) selenoprotein B, glycine/betaine/sarcosine/D-proline reductase family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00600840

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19109.11.0003292389192957e-45hypothetical protein (127 aa)
OxytrichaContig7608.0.g753.9989916100764785e-24Tesmin/TSO1-like CXC domain
WormBaseWBGene000030379.995317835403734e-19locus:lin-54 Protein lin-54
status:Partially_confirmed
UniProt:Q95QD7 protein_id:C
AB05229.1
DictyBaseDDB_G02815194.0002685161515803e-16lin54 on chromosome: 3 positio
n 4464773 to 4467683

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29417875: Zhang J, Yan G, Tian M, Ma Y, Xiong J, Miao W (2018) A DP-like transcription factor protein interacts with E2fl1 to regulate meiosis in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 17(5):634-642

Sequences

>TTHERM_00600840(coding)
ATGTAAAAGGGTAATAGCAACACAAACTATATGTTAGACTCAAATAGGAGCAATATTCAA
GAAGAGCTAAAAAACTTCTACAGCCAAATGGAGATTTCTCCTAATCATAGCTTTAATAAC
TTAGATACTCACAATTTTGAATATTGTGCATCAAAAAATTAAATGGGATTTAGTGAAGGT
GAAGGTACAAACGAAACAAAAGTAAAGAATATCCTAGCTCACTACTTAGAAGAAAACGAT
GAAGAAATTAGCAAGACAGAAGATCACGCAACTGAGTCAGTAAACCAAAGCTGCTGTGAC
CTTAAAAAATAGCCTGATTATAATTTTCACAGTTTTTCGGATTAAAATTATTAGTATGGT
AAGGAATCGCCATCTTCTGATTTTCGCTTATTTTAGCATGAAGATGATATAGCAAATGAT
CTTTCATCTTCAGAGAAGCTTGACTTTTTCGATATCAATGAATAGACTATATATAAGTAG
AAGTTGAGTTATACAACTCAAGTTGAAGACTTTATAATGAACTGTACACCAAATCCATTT
TGCTTTGAAGCTTAAAAAGCTGTAGAAAAGATATTCTTAAATAAAAGGATTGAAGAAATG
AAGAAAAAAAGACTACTAACAAAGAAGCTTATGAACAAATATCAAAACAAAAAAGAAAAG
GACATATTTTTGTAGCAAAGCTATAACTAGCTTTATGAAGATGTAAAAGATAACAAAGAA
GAGCCTAACATTAGTCCACGCAAAATATTTTAAAAGGAATTTATATAATAAGAAGAATAA
ATAGAAGATCTCAACAAAAACAGTAATAGTAATAATAATCCACAATAAATTCTGCCAAAT
TTCGATTAGTCTTCGCTAAGCATAAACGCTAATCAAGCAATAGTAATAAATAATAATATG
TAAAAAAAATAATAACCAAATAACAAGTTGCAAAGTATTGATAGTAGTAAAGAGGGGGAA
ATTTTGAGAGTTTCAAAAACTCCTTGCAAATGCAGAAAATCTCTTTGTCTTAAACTTTAC
TGCGAATGCTTTGCAAGAGGTGAAATTTGTGGACATGCTTGCGTTTGCTTAGAATGTAAA
AATTCTAAAAATCACTTAGAATTAAGAAATGAAGCCATTAAGGTTATTGAAGCCAAAAAT
CCATCAGCTTTTTTGTTTTCTAACATTTAAGCAACAACAAATCTTAATAATTAAGATAAA
AACCTTACAAATATGTAACTTGAATAATAAGACATGGCTATGGATATAAGAAGAGGTTGT
AATTGCAAAAAATCTAAATGCAAAAAGAAATATTGTGAGTGCTATATGATAGGGAAAAGA
TGTTCTTCACTTTGCCAATGTTTAAATTGCTCTAATAATAATTCTCACTCACACACCATA
TCTTCTTACAGCTAGTCTCCTATTTAGCACAATGATTTATTAGACTCGAACTAAGAGTCA
AAAAACAATTCAATAATTAAATTAAAACCAGTTCTAGCAAAGGAATAGAAAAAATTATTT
GATATTGTAAATCAAGAATATTAGAATATCCAACAAGATGACTAGTCGTTATTGCATACT
CTTAAAGATTCTAATAAATAATATAAATTACAAGGAAAAAGCTAATACCAAAAATAGGAA
TCACCTTAATTAATAAAATAAAAAAATTTTTAGAATTAAATACTTCCAAAAAAAACAGAA
ATATTTGCTTTTAAAGATACAATTCGTCATACAGATAATTAAAAAGATAATACGACATAT
TCTTAATTTGAAGCTAAATAAACCACAGATTATAGCCAATTGCATTCAAGTAAAGAGAAT
AAGATTAATTTAAAAGCTACTAAAAAGATTATAAAAACAAAAAAAGTTAATCACACAAAT
TATTATTGA


>TTHERM_00600840(protein)
MQKGNSNTNYMLDSNRSNIQEELKNFYSQMEISPNHSFNNLDTHNFEYCASKNQMGFSEG
EGTNETKVKNILAHYLEENDEEISKTEDHATESVNQSCCDLKKQPDYNFHSFSDQNYQYG
KESPSSDFRLFQHEDDIANDLSSSEKLDFFDINEQTIYKQKLSYTTQVEDFIMNCTPNPF
CFEAQKAVEKIFLNKRIEEMKKKRLLTKKLMNKYQNKKEKDIFLQQSYNQLYEDVKDNKE
EPNISPRKIFQKEFIQQEEQIEDLNKNSNSNNNPQQILPNFDQSSLSINANQAIVINNNM
QKKQQPNNKLQSIDSSKEGEILRVSKTPCKCRKSLCLKLYCECFARGEICGHACVCLECK
NSKNHLELRNEAIKVIEAKNPSAFLFSNIQATTNLNNQDKNLTNMQLEQQDMAMDIRRGC
NCKKSKCKKKYCECYMIGKRCSSLCQCLNCSNNNSHSHTISSYSQSPIQHNDLLDSNQES
KNNSIIKLKPVLAKEQKKLFDIVNQEYQNIQQDDQSLLHTLKDSNKQYKLQGKSQYQKQE
SPQLIKQKNFQNQILPKKTEIFAFKDTIRHTDNQKDNTTYSQFEAKQTTDYSQLHSSKEN
KINLKATKKIIKTKKVNHTNYY


>TTHERM_00600840(gene)
AATTTTTGTGCCAAAAAACAAAAAATTATTAAAACAAATTTTGTTTGATTTTTGGATTTA
ATAAAAAATAGATACTTAATTTTTCTATATAATAAATTCAACAAAAATTAACAGGAAAGA
AGAAAACAGAATATATCGCAAACTTCATTAATATAAAATGTAAAAGGGTAATAGCAACAC
AAACTATATGTTAGACTCAAATAGGAGCAATATTCAAGAAGAGCTAAAAAACTTCTACAG
CCAAATGGAGATTTCTCCTAATCATAGCTTTAATAACTTAGATACTCACAATTTTGAGTA
AGATGATTAGATTCATTGCTTGCTATTTTTTCTCTTTTTCATAGATTTTAATTTCTTTGT
TTTTATTATCCTTTAATTAGATATTGTGCATCAAAAAATTAAATGGGATTTAGTGAAGGT
GAAGGTACAAACGAAACAAAAGTAAAGAATATCCTAGCTCACTACTTAGAAGAAAACGAT
GAAGAAATTAGCAAGACAGAAGATCAGTAAATAAAATTAATGCTTTTTAGAAATATTTTA
TTCATAAATTTGTTTTCTTTAATTGATAGCGCAACTGAGTCAGTAAACCAAAGCTGCTGT
GACCTTAAAAAATAGCCTGATTATAATTTTCACAGTTTTTCGGATTAAAATTATTAGTAT
GGTAAGGAATCGCCATCTTCTGATTTTCGCTTATTTTAGCATGAAGATGATATAGCAAAT
GATCTTTCATCTTCAGAGAAGCTTGACTTTTTCGATATCAATGAATAGACTATATATAAG
TAGAAGTTGAGTTATACAACTCAAGTTGAAGACTTTATAATGAACTGTACACCAAATCCA
TTTTGCTTTGAAGCTTAAAAAGCTGTAGAAAAGATATTCTTAAATAAAAGGATTGAAGAA
ATGAAGAAAAAAAGACTACTAACAAAGAAGCTTATGAACAAATATCAAAACAAAAAAGAA
AAGGACATATTTTTGTAGCAAAGCTATAACTAGCTTTATGAAGATGTAAAAGATAACAAA
GAAGAGCCTAACATTAGTCCACGCAAAATATTTTAAAAGGAATTTATATAATAAGAAGAA
TAAATAGAAGATCTCAACAAAAACAGTAATAGTAATAATAATCCACAATAAATTCTGCCA
AATTTCGATTAGTCTTCGCTAAGCATAAACGCTAATCAAGCAATAGTAATAAATAATAAT
ATGTAAAAAAAATAATAACCAAATAACAAGTTGCAAAGTATTGATAGTAGTAAAGAGGGG
GAAATTTTGAGAGTTTCAAAAACTCCTTGCAAATGCAGAAAATCTCTTTGTCTTAAACTT
TACTGCGAATGCTTTGCAAGAGGTGAAATTTGTGGACATGCTTGCGTTTGCTTAGAATGT
AAAAATTCTAAAAATCACTTAGAATTAAGAAATGAAGCCATTAAGGTTATTGAAGCCAAA
AATCCATCAGCTTTTTTGTTTTCTAACATTTAAGCAACAACAAATCTTAATAATTAAGAT
AAAAACCTTACAAATATGTAACTTGAATAATAAGACATGGCTATGGATATAAGAAGAGGT
TGTAATTGCAAAAAATCTAAATGCAAAAAGAAATATTGTGAGTGCTATATGATAGGGAAA
AGATGTTCTTCACTTTGCCAATGTTTAAATTGCTCTAATAATAATTCTCACTCACACACC
ATATCTTCTTACAGCTAGTCTCCTATTTAGCACAATGATTTATTAGACTCGAACTAAGAG
TCAAAAAACAATTCAATAATTAAATTAAAACCAGTTCTAGCAAAGGAATAGAAAAAATTA
TTTGATATTGTAAATCAAGAATATTAGAATATCCAACAAGATGACTAGTCGTTATTGCAT
ACTCTTAAAGATTCTAATAAATAATATAAATTACAAGGAAAAAGCTAATACCAAAAATAG
GAATCACCTTAATTAATAAAATAAAAAAATTTTTAGAATTAAATACTTCCAAAAAAAACA
GAAATATTTGCTTTTAAAGATACAATTCGTCATACAGATAATTAAAAAGATAATACGACA
TATTCTTAATTTGAAGCTAAATAAACCACAGATTATAGCCAATTGCATTCAAGTAAAGAG
AATAAGATTAATTTAAAAGCTACTAAAAAGATTATAAAAACAAAAAAAGTTAATCACACA
AATTATTATTGATTTTCTTCCTTTTTTCAGCCTCCTCATTCATTCATTAATTGAAAATCT
ACTAAATATATTAAATAATTTAAATGTAAAACAAATACAATAATATAATTATAAAAACAA
ACAACTAACCAGCACTCAAATATTAAATTAAAACTACTTTTATATATATTATATATATTT
ATAAGAATCATTTAATTTTATATCTATGTATATTTACTTACTTTCAAGTTTGATCAAATA
AAAAATTATTCAAAAAACGCAATAA