Identifiers and Description

Gene Model Identifier

TTHERM_00782060

Standard Name

TCT1B

Aliases

PreTt25508 | 131.m00081 | 3813.m01583 | Tctex1B

Description

Light chain subunit of ciliary three-headed outer arm dynein (OAD), two-headed inner arm dynein (IAD) complex 1, and non-axonemal dynein complex 1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00782060

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11407.13.0008725323024365e-87tctex-1 family protein (124 aa
)
OxytrichaContig7426.0.g143.999970367130025e-21Tctex-1 family
DictyBaseDDB_G02845890.000000000000020000882446601127dlcA on chromosome: 4 position
2178851 to 2179736
WormBaseWBGene000087640.0000029996948234116693locus:dylt-1 status:Confirme
d UniProt:Q19416 protein_i
d:CAA95796.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00782060(coding)
ATGGCTGAGGATAATATTGATGAACAAACATTTTAGCAGGACGAAACAGAAAAGCAAGTA
GTTACCTATATAGAAAAAGTTTTGTAAGGAAAAGATTATAAAGAAGATATGGTTCCTCAA
TGGATTAACGAAATATGCGAATAAACATTAGAATACTTAATAAAGCAGTAAAAACCCTAT
AAATATATGGTAAATTGTATGATAATGCAAAGTACGGGTACGGGAGCGTGCGCTGCGTAG
AGTTGCTTTTGGGATGGTGTTGTAGATGGTATCGCAATAATTAAATGGCCTAAGGATAGC
AAAGAATATTCAAAAAATTAAGTTAGTGCAATAGTTACAGTATTTGCATCATCATTAGTT
CCTAATCATTGA


>TTHERM_00782060(protein)
MAEDNIDEQTFQQDETEKQVVTYIEKVLQGKDYKEDMVPQWINEICEQTLEYLIKQQKPY
KYMVNCMIMQSTGTGACAAQSCFWDGVVDGIAIIKWPKDSKEYSKNQVSAIVTVFASSLV
PNH


>TTHERM_00782060(gene)
ATGGCTGAGGATAATATTGATGAACAAACATTTTAGCAGGACGAAACAGAAAAGCAAGTA
GTTACCTATATAGAAAAAGTTTTGTAAGGAAAAGATTATAAAGAAGATATGGTTCCTCAA
TGGATTAACGAAATATGCGAATAAACATTAGAATACTTAATAAAGCAGTAAAAACCCTAT
AAATATATGGTAAATTGTATGATAATGCAAAGTACGGGTACGGGAGCGTGCGCTGCGTAG
AGTTGCTTTTGGGATGGTGTTGTAGATGGTATCGCAATAATTAAATGGCCTAAGGATAGC
AAAGAATATTCAAAAAATTAAGTTAGTGCAATAGTTACAGTATTTGCATCATCATTAGTT
CCTAATCATTGA