Identifiers and Description

Gene Model Identifier

TTHERM_00485800

Standard Name

TCT1A

Aliases

PreTt19512 | 59.m00150 | 3680.m00007 | Tctex1A

Description

Light chain subunit of ciliary three-headed outer arm dynein (OAD), two-headed inner arm dynein (IAD) complex 1, and non-axonemal dynein complex 1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00485800

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12081.12.0009381340492598e-66tctex-1 family protein (110 aa
)
DictyBaseDDB_G02845899.997019043202629e-21dlcA on chromosome: 4 position
2178851 to 2179736
Stentor CoeruleusSteCoe_59620.00000000000009357622968840175
OxytrichaContig10748.0.g60.00000000000020009182674645818Tctex-1 family
WormBaseWBGene000087640.0000000010002658722841845locus:dylt-1 status:Confirme
d UniProt:Q19416 protein_i
d:CAA95796.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00485800(coding)
ATGGAAGAAGTTATTTTCAACAATCTCAAAAATTAAATTAACGATAAAGCTTTATAAATT
ATTAAAGAAAAAATAGATAAAAAGTCATATAATTCTAATGATGCTCAAAGGTGGACTAAC
TAATTATGCGATGATGTTTTAAAATTTCTCACTACTTTAAATAAAAACTTTAAATTTATT
GTAAACTGCATGATCATGCAAAAAAGTGATGCAGGTTTACATATTTCTGGTTCTTGCTAT
TGGGATAATGAAATAGATGGCAGTTTGGTAGTAAAATATGAAACTAACTCAATAGTTTGT
ATCATGAATATATTTGGGTGTGCTTTGTGA


>TTHERM_00485800(protein)
MEEVIFNNLKNQINDKALQIIKEKIDKKSYNSNDAQRWTNQLCDDVLKFLTTLNKNFKFI
VNCMIMQKSDAGLHISGSCYWDNEIDGSLVVKYETNSIVCIMNIFGCAL


>TTHERM_00485800(gene)
ATGGAAGAAGTTATTTTCAACAATCTCAAAAATTAAATTAACGATAAAGCTTTATAAATT
ATTAAAGAAAAAATAGATAAAAAGTCATATAATTCTAATGATGCTCAAAGGTGGACTAAC
TAATTATGCGATGATGTTTTAAAATTTCTCACTACTTTAAATAAAAACTTTAAATTTATT
GTAAACTGCATGATCATGCAAAAAAGTGATGCAGGTTTACATATTTCTGGTTCTTGCTAT
TGGGATAATGAAATAGATGGCAGTTTGGTAGTAAAATATGAAACTAACTCAATAGTTTGT
ATCATGAATATATTTGGGTGTGCTTTGTGA