Identifiers and Description

Gene Model Identifier

TTHERM_00122290

Standard Name

TCP1 (TCP1 Ortholog)

Aliases

PreTt27244 | 8.m00504 | 3812.m02530

Description

TCP-1/cpn60 chaperonin family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00122290

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_136250
WormBaseWBGene000003779.997093137033517e-262locus:cct-1 T-complex protei
n 1 subunit alpha status:Con
firmed UniProt:P41988 prot
ein_id:CAA91308.1
Tetrahymena borealisEI9_11694.19.997093137033517e-262TCP-1/cpn60 chaperonin family
protein (548 aa)
DictyBaseDDB_G02691909.997093137033517e-262tcp1 on chromosome: 1 position
4885046 to 4886981
OxytrichaContig22651.0.g299.997093137033517e-262TCP-1/cpn60 chaperonin family
SGDYDR212W9.997093137033517e-262TCP1 Alpha subunit of chaperon
in-containing T-complex, which
mediates protein folding in t
he cytosol; involved in actin
cytoskeleton maintenance; over
expression in neurons suppress
es formation of pathogenic con
formations of huntingtin prote
in

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00122290(coding)
ATGAAAATATCTAAAATTTTAAAAATTAATGATTAAAAAAATAAAAATAAATAAAAATAA
AAAGCAAAAAAATACAAATAATCTTTAAACAAAAAAAAGAATTTATTCATTCACAAAAAT
AAAGCAAAATCAACTCTAGTTTAACTAATTAAATATAGTATTCTAAATAAAATGGCTCCC
TCTGTTGGTATTTTAGGTGAAAGAGATTAAGGTCAAGATGTCAGAACCAATAATGTTACT
GCTGTCATGGCTATTGCTAATATTGTTAAATCTTCTTTGGGTCCTCAAGGTCTCGATAAG
ATGCTCGTCGATGAAGTCGGTGATGTCACCATTACAAATGATGGTGCTACCATTTTGAGA
CAATTAGAAGTTTAACACCCTGCTGCTAAGGTTATTGTTGAATTATCTTAATTATAAGAC
AAGGAAGTTGGTGATGGTACTACCTCCGTTGTTATTTTGGCTGCTGAATTATTGAAGAGA
GCCAACGAATTAATTAAGAACAAGGTTCATCCTACTAACATTATTACTGGCTTTAAGATT
GCTGCTAAGGAAGCTTGCAACTACATTAAGGATCACCTTGCTATTTCAGTCGAACACCTC
GGCCGTGAAGCTCTCATTAATGTTGCCAAGACTTCCATGTCTTCCAAGCTTATTGGTCCC
GAATCCAATCTTTTCTCTTCCATCGTTGTTGATGCTGTTGAAACCGTCAAGATGACTAAC
CTTTCAGGAGAAACCAAGTATCCTATCAAGAACGTTAAGATCGTTAAGAGTCACGGTTAG
AGCACTTTATAATCCTAATTAATTAAAGGTTATGTTTTACAAACTCAAAGAGCTGATCAA
TAAATGAAAACTAGAATCGAAAAAGCCAAGATTGCTTTACTTGACTTCAACTTAAACAAA
TTCCGTTTACAAATGGGTATATAAATTTTGGTTAACGACCCTAAGAATTTGGAAAAGATT
CGTTTCAAAGAATGTGAAATTTTGAAAGAAAGATGTAAGAAAATTATTGAAGCTGGTGCC
AACGTTATCGTCACCTCTGCTGGTATGGATGATGTTGCTACCAAGTACCTCGTTGAAGCT
GGTGTCTTAGGTATTAGAAGAGTTGATAAGCACGATCTCCGTAGAATCGCCAAGGCTTCT
GGAGCTACCGTTGTTACCACTTTGGCTACTCCTGAAGGTGATGAAGTTTTTGAAGCTTCC
TACTTGGGTGAATGTGCTGAAGTTTACGAAGAAGCTGTTGGTGATAACGACTGCATCTTC
TTTAGGGGAATGAAAAAGTCTAACTGTGCTTCCATCATCATTAGAGGTGCCAACGAATTT
ATGTGCGAAGAAGTCGATAGATCTTTACATGACTCTCTCTGCGTCGTTAAGAGAACCTTA
GAATCTGGATACGTCGTTCCTGGTGGTGGTGCTGTTGAAATTGCTTTGAGCATTAAGTTA
GAAGACTTCGCCAGAACTTTGGGTAACAAAGAATAAACTGCTGTTGCTGAATTCTGTGAA
GCCTTAAACATTATTCCTAAGGTCCTTGCTGCAAATGCTGCTCAAGATGCCACTGAATTA
GTTTCTAAGTTAAGAGCCCTCCACGCTGCCTCTCAATCTTCCGATGATCCCACCAAGAAG
GAACTTAAAAACTGCGGTCTTGACCTCTCCCTCGGTAAAGTTAGAAACAATGTTAAGGCT
GGTGTCCTTGAACCTATGGTTTCTAAGATTAAATCTCTTAGATTTGCCACTGAAGCCGCT
ATTACTATTTTAAGAATTGACGATATGATTAAATTAAATCCTCAACAAGAAGAATTACCT
CAAGGAAGACATTGA


>TTHERM_00122290(protein)
MKISKILKINDQKNKNKQKQKAKKYKQSLNKKKNLFIHKNKAKSTLVQLIKYSILNKMAP
SVGILGERDQGQDVRTNNVTAVMAIANIVKSSLGPQGLDKMLVDEVGDVTITNDGATILR
QLEVQHPAAKVIVELSQLQDKEVGDGTTSVVILAAELLKRANELIKNKVHPTNIITGFKI
AAKEACNYIKDHLAISVEHLGREALINVAKTSMSSKLIGPESNLFSSIVVDAVETVKMTN
LSGETKYPIKNVKIVKSHGQSTLQSQLIKGYVLQTQRADQQMKTRIEKAKIALLDFNLNK
FRLQMGIQILVNDPKNLEKIRFKECEILKERCKKIIEAGANVIVTSAGMDDVATKYLVEA
GVLGIRRVDKHDLRRIAKASGATVVTTLATPEGDEVFEASYLGECAEVYEEAVGDNDCIF
FRGMKKSNCASIIIRGANEFMCEEVDRSLHDSLCVVKRTLESGYVVPGGGAVEIALSIKL
EDFARTLGNKEQTAVAEFCEALNIIPKVLAANAAQDATELVSKLRALHAASQSSDDPTKK
ELKNCGLDLSLGKVRNNVKAGVLEPMVSKIKSLRFATEAAITILRIDDMIKLNPQQEELP
QGRH


>TTHERM_00122290(gene)
ATGAAAATATCTAAAATTTTAAAAATTAATGATTAAAAAAATAAAAATAAATAAAAATAA
AAAGCAAAAAAATACAAATAATCTTTAAACAAAAAAAAGAATTTATTCATTCACAAAAAT
AAAGCAAAATCAACTCTAGTTTAACTAATTAAATATAGTATTCTAAATAAAATGGCTCCC
TCTGTTGGTATTTTAGGTGAAAGAGATTAAGGTCAAGATGTCAGAACCAATAATGGTAAT
TTATTACAAGATGATTAACTTTGCTGCCTTTTACTTAATATTTTTCATTGATTATTTCTA
ACTCAAATTCTGTTTGTTTGCTGAAATTATTTTCAAAAATATTATGTTTGTTTAACCAAT
TTAATTACAAAAATGAACTAATGCACAGTTCAGTTACAAATGAAATAATATATATAAACA
ATAACAATTTGACATTATATCAATCTTTATTATTTAATAAATAGTTACTGCTGTCATGGC
TATTGCTAATATTGTTAAATCTTCTTTGGGTCCTCAAGGTCTCGATAAGATGCTCGTCGA
TGAAGTCGGTGATGTCACCATTACAAATGATGGTAATAAACATCATTCATAAAATATCCC
AATAGCTTAATTCTTTTTCTTCTTCTTCTCCATAGATAATAGTTTCTTTTAATTTTACAC
CTTTAGAAAAGAATGAACAAAGTTGCATGAATACTCCAAAACAATAACAACACAATCAAG
CTACTTTGATAAGAAATTGTAAAATAGGAAATAAAAAACATAATAAACCACCAAAATGAA
ATCACAAATACAATAATAAGCATACAATTAACAATTAAATAGGAGAAAATTTAGCGAACC
TATAAAAAAACATTAAATTGAGTAAAAGAGAGTATTCAAAGTCAGTAAAAGATAAAATCT
ACTTACTAAAATTTAACAAAAACATACAAAGAAAGAAACAAACAAACATATAAATTTAGA
AGAAGAAAATGAAGCTATTTTATAAAATATCTTTGAGTTTTTAACATTTTTAATGATAAT
AGGTGCTACCATTTTGAGACAATTAGAAGTTTAACACCCTGCTGCTAAGGTTATTGTTGA
ATTATCTTAATTATAAGACAAGGAAGTTGGTGATGGTACTACCTCCGTTGTTATTTTGGC
TGCTGAATTATTGAAGAGAGCCAACGAATTAATTAAGAACAAGGTTCATCCTACTAACAT
TATTACTGGCTTTAAGATTGCTGCTAAGGAAGCTTGCAACTACATTAAGGATCACCTTGC
TATTTCAGTCGAACACCTCGGCCGTGAAGCTCTCATTAATGTTGCCAAGACTTCCATGTC
TTCCAAGCTTATTGGTCCCGAATCCAATCTTTTCTCTTCCATCGTTGTTGATGCTGTTGA
AACCGTAAATAAACATCAAAATACTTTTAATTCATTCAACATAAAATAATAAAAATCAAT
TTTAAAAATTAAACTTTGAATCATTAATCAATTAATTAATTTGTTTATTTTAACAATAAA
TAGGTCAAGATGACTAACCTTTCAGGAGAAACCAAGTATCCTATCAAGAACGTTAAGATC
GTTAAGAGTCACGGTTAGAGCACTTTATAATCCTAATTAATTAAAGGTTATGTTTTACAA
ACTCAAAGAGCTGATCAATAAATGAAAACTAGAATCGAAAAAGCCAAGATTGCTTTACTT
GACTTCAACTTAAACAAATTCCGTTTACAAATGGGTATATAAATTTTGGTTAACGACCCT
AAGAATTTGGAAAAGATTCGTTTCAAAGAATGTGAAATTTTGAAAGAAAGATGTAAGAAA
ATTATTGAAGCTGGTGCCAACGTTATCGTCACCTCTGCTGGTATGGATGATGTTGCTACC
AAGTACCTCGTTGAAGCTGGTGTCTTAGGTATTAGAAGAGTTGATAAGCACGATCTCCGT
AGAATCGCCAAGGCTTCTGGAGGTAAAAAATTATAAATAAAAATAAACATAGATAAAAAG
ATAGTTGATATCTTTATTTTTATTCAATAAAAATAAGAATAAAGATTTAAAATAAATTAT
TTTTATTTAATATTTAAATTAATAAAATTTTTAAATAATATTTAGCTACCGTTGTTACCA
CTTTGGCTACTCCTGAAGGTGATGAAGTTTTTGAAGCTTCCTACTTGGGTGAATGTGCTG
AAGTTTACGAAGAAGCTGTTGGTGATAACGACTGCATCTTCTTTAGGGGAATGAAAAAGT
CTAACTGTGCTTCCATCATCATTAGAGGTGCCAACGAATTTATGTGCGAAGAAGTCGATA
GGTATTTTATTAATTAGTTTTATTATTTAAGCAAATAACTGAAAAATAAATGCTTGTTTT
GTGGCTAAATTAACATCAAAATTAATTATGATATATAAATAAATGAATTTTAATTAAACT
GAATTATTTTTATTAATTGAAAAGATCTTTACATGACTCTCTCTGCGTCGTTAAGAGAAC
CTTAGAATCTGGATACGTCGTTCCTGGTGGTGGTGCTGTTGAAATTGCTTTGAGCATTAA
GTTAGAAGACTTCGCCAGAACTTTGGGTAACAAAGAATAAACTGCTGTTGCTGAATTCTG
TGAAGCCTTAAACATTATTCCTAAGGTCCTTGCTGCAAATGCTGCTCAAGATGCCACTGA
ATTAGTTTCTAAGTTAAGAGCCCTCCACGCTGCCTCTCAATCTTCCGATGATCCCACCAA
GAAGGAACTTAAAAACTGCGGTCTTGACCTCTCCCTCGGTAAAGTTAGAAACAATGTTAA
GGCTGGTGTCCTTGAACCTATGGTTTCTAAGATTAAATCTCTTAGGTAATAAATTAATTA
ATTAAATAATTAATTTTATAATTTAAATGAATTTATTTATAAATTTAAATAGATTTGCCA
CTGAAGCCGCTATTACTATTTTAAGAATTGACGATATGATTAAATTAAATCCTCAACAAG
AAGAATTACCTCAAGGAAGACATTGA