Identifiers and Description

Gene Model Identifier

TTHERM_00590370

Standard Name

TCE1 (Tetrahymena Cation-Exchanger )

Aliases

PreTt24151 | 81.m00208 | 3726.m00085

Description

Putative K+-dependent Na+/Ca+ exchanger; transcription of TCE1 induced following exocytosis; may be cargo protein of dense core secretory granules

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01699 ) Sodium/calcium exchanger protein
  • ( PF07690 ) transporter, major facilitator family
  • ( TIGR00367 ) K+-dependent Na+/Ca+ exchanger homolog

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00590370

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06706.19.997093137033517e-262sodium/calcium exchanger prote
in (598 aa)
WormBaseWBGene000035724.000437458487249e-40locus:ncx-7 Putative sodium/
calcium exchanger 7 status:P
artially_confirmed UniProt:P
34322 protein_id:CAA82341.3
OxytrichaContig21787.0.g1131.999981404597394e-31Sodium/calcium exchanger prote
in
Stentor CoeruleusSteCoe_304481.0530617357553812e-20
SGDYDL206W0.000000005997038937208364YDL206W Putative protein of un
known function; YDL206W is not
an essential protein

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:12456006: Haddad A, Bowman GR, Turkewitz AP (2002) New class of cargo protein in Tetrahymena thermophila dense core secretory granules. Eukaryotic cell 1(4):583-93

Sequences

>TTHERM_00590370(coding)
ATGTCTTCAGATACTTAATGTACATTTAGAAATATATAAGAGTTGCCATAAGATTAAGTA
TGCGATTTTGTAGATTAAAACTGTAATGTTGAATAATTAGTTAAGTTTTCTTACTTTTAT
TTCTGTCAAGTTAAGCAAAATATTATTGTATTAGATCTCCTTACAATTTTAATACCGTTA
TACGCATTCCGTATGCTGAGTCAAATATCTGAATATTATTTATCACCAGCTCTAGCTAAG
GTATCTAAATGCTTCAAACTTTCATAGTCAGTTGCTGGTGTGACTCTTCTTGCTCTAGGA
AACGGTGGCCCTGATGTTGCAACAGCTATTGTAGCTGGTAGCAGTGGTGGTGATTCGATT
ACAATAGCTGTAGGATCTATTTTTGGTGCAGGTCTATTCGTCACTACATACACTCTTCAA
AATGTTATTCAAAATGCAGGATCAATACACATCAAATCAAAAACGTTCGTAAGAGATATG
GTATTTTATTTAATTGGGTGCTGTGTTGTATTTATCTATACAATAGTAGGTTCAATTAAT
TTAGGAATGGCTATTGGTTTTATGTCTATCTATGGATTATTCTTATTCACAGTTATTTAC
TAAGATCGTTAAAGAGCTAAATAAGAAATAGCTTAGAGTAAAATTAGAAAAATGGACACA
ATCTAGACTTAAAGGGTTGAAGAGGCTTTACCAGAAATTCCTTTAGAATAAAAACAGGAA
GTTCAAATAAATTGCATCTAAGCAAACCAAATGCCAGCCGTGCTGAATACTCTTCATGAT
TAAAATGAAGAAAGAGATATAGAAGGCAAATCCTTTGTTTAAGATGAATAAAATAATTAA
AACAAAGAAGGATATGATTCTATTAAAAGGTAGGAGACTGCTCCTTATAACAAAAACTAA
ACTGAGGAAGAAAACTCTGAAGAAAAAGTTAAAGATATAATGACTGAAAAATATGAAAAC
TTTTGGGATAAATTCAAAGAAATGGGTATCTTAGAAAGATTATTAATACTTACTGAAATA
CCTATTGATGTTGCTAGATATTTAATTATCCCTCCTGCCGAGGAGAATTAATGGAATAAA
TGGAGGGCTATGATAACAACAATAACAGGACCTCTTGCCTTTATGTGGGGCTCATAATAA
AATTTAAATGCCACTATCAATGATGAAGGGTTTTTGGTGATATATATAGTACTAATAATT
TCGTTTATTGCATCAATATTGATATTCTTCTTTACTAAAAATAACTAACCTCCTCAAATA
ATGTGGCTATTTTCTATATTTTCATTTGTTGTTGCAGTTGTTTTACTTGGCTAAGCTGCT
TAAGTTATGATTGATTTTATTAATTTTTTCTAAATTGTGACAAATATGAATAAGACATTT
TTGGGTATGACCGTTTTAGCTTGGGGAAACTCAGCAACTGACTTTTTCCTTAACTCCAGT
CTTGCTTCAATAGGATATGGAGTTATGGCTGCTACTGGGTGCTTTGCAGGCTAAGCCTTT
GATCTTTACTTAGGTTTTGGAATTGCATTGATTTTCTATTCAAATTAATCTAATAGCAGT
TTATCAATTTTTACTGGATCTAGTACCCTTGATTGGATTAACAATTCTATTGCTATTAGT
GTTATCTTATTTGTTATTATATCTTCAGCAATATCTATAATAGTTGGTTTAAAGCTAAAG
TTTAGTTATGATTAAGGTAAATACACGACTTTTCTTAAATATTACTACTTATGTGCCTTA
ACCTTCTGTATAATCTTATGTGCTGCAGATTAATTTTACGAATGA


>TTHERM_00590370(protein)
MSSDTQCTFRNIQELPQDQVCDFVDQNCNVEQLVKFSYFYFCQVKQNIIVLDLLTILIPL
YAFRMLSQISEYYLSPALAKVSKCFKLSQSVAGVTLLALGNGGPDVATAIVAGSSGGDSI
TIAVGSIFGAGLFVTTYTLQNVIQNAGSIHIKSKTFVRDMVFYLIGCCVVFIYTIVGSIN
LGMAIGFMSIYGLFLFTVIYQDRQRAKQEIAQSKIRKMDTIQTQRVEEALPEIPLEQKQE
VQINCIQANQMPAVLNTLHDQNEERDIEGKSFVQDEQNNQNKEGYDSIKRQETAPYNKNQ
TEEENSEEKVKDIMTEKYENFWDKFKEMGILERLLILTEIPIDVARYLIIPPAEENQWNK
WRAMITTITGPLAFMWGSQQNLNATINDEGFLVIYIVLIISFIASILIFFFTKNNQPPQI
MWLFSIFSFVVAVVLLGQAAQVMIDFINFFQIVTNMNKTFLGMTVLAWGNSATDFFLNSS
LASIGYGVMAATGCFAGQAFDLYLGFGIALIFYSNQSNSSLSIFTGSSTLDWINNSIAIS
VILFVIISSAISIIVGLKLKFSYDQGKYTTFLKYYYLCALTFCIILCAADQFYE


>TTHERM_00590370(gene)
ATGTCTTCAGATACTTAATGTACATTTAGAAATATATAAGAGTTGCCATAAGATTAAGTA
TGCGATTTTGTAGATTAAAACTGTAATGTTGAATAATTAGTTAAGTTTTCTTACTTTTAT
TTCTGTCAAGTTAAGCAAAATATTATTGTATTAGATCTCCTTACAGTAAAAAAACAATGA
AAATTTTTCCTAAATATTGAAATATATTATTAAAAAAATTAGATTTTAATACCGTTATAC
GCATTCCGTATGCTGAGTCAAATATCTGAATATTATTTATCACCAGCTCTAGCTAAGGTA
TCTAAATGCTTCAAACTTTCATAGTCAGTTGCTGGTGTGACTCTTCTTGCTCTAGGAAAC
GGTGGCCCTGATGTTGCAACAGCTATTGTAGCTGGTAGCAGTGGTGGTGATTCGATTACA
ATAGCTGTAGGATCTATTTTTGGTGCAGGTCTATTCGTCACTACATACACTCTTCAAAAT
GTTATTCAAAATGCAGGATCAATACACGTAAATACTATGATGATTTAATTTTTTAAACTT
TAATAGTTTAATGACGAGAAGTTTTTTACTTTAATAACATTTTCAACATTTTATAAAATA
ATTGAGATAAAAATAAATTTTAATACAAAAACCCATTTTCATTACGTTAAAAAATTAACT
TTCCAAAAGCAGCGCCAAAAGAAATTACAATCTATCATCACAAATAAATTCTACATTTAA
ATTTACTTATATTTTCTATTATTAGAGAACTTAAAAAATACTTATTTTACTATTTGATAT
ATGGACAACCAATATTCTTAAATCAAATATCAAAAATTATCCCATTGAAAATAAAAAATT
TTACTACCATATTTCTTTATTCTATATCAAGGTTCTAAAAAATAAAAAATTTTCAGATAA
AATAATTTTAGTTGTTGTGAAAAATCAAGTTAAATTGATGATTTAGAATATCAAAATAAT
TTGATAATGATCTTAAAAAATGATTGAGAAAAATACCAAACTTTTTGATTTCACCTTAAA
GTGTTTTTTGTCCAGGAGTGTATTAATAATTTTATTTTTCACTTTAAATATAATTTTAAG
GTATTATTATGATTTTAATTTAAAATAGAAATGAATATTTTTTTTGTTAAGTATTATTTT
TTTATAATTAGATCAAATCAAAAACGTTCGTAAGAGATATGGTATTTTATTTAATTGGGT
GCTGTGTTGTATTTATCTATACAATAGTAGGTTCAATTAATTTAGGAATGGCTATTGGTT
TTATGTCTATCTATGGATTGTAAAAAATATTTATTTAAATTTTCCGTTTTTTTAACTATA
AATTTATTTAATTCAAAGATTCTTATTCACAGTTATTTACTAAGATCGTTAAAGAGCTAA
ATAAGAAATAGCTTAGAGTAAAATTAGAAAAATGGACACAATCTAGAGTAATCTTTTATT
TGAATTTTCTTTTATATAATAACTTAAAATGTTAAAGCTTAAAGGGTTGAAGAGGCTTTA
CCAGAAATTCCTTTAGAATAAAAACAGGAAGTTCAAATAAATTGCATCTAAGCAAACCAA
ATGCCAGCCGTGCTGAATACTCTTCATGAGTAAAATTCTAAACAATATGTATTAGTTTCT
AATTGAATAAATTTATAAATTGATAGTTAAAATGAAGAAAGAGATATAGAAGGCAAATCC
TTTGTTTAAGATGAAGTAAAATAGAAAAAAGAAAAAAAATCTTATTTTTAATTTTTTTAC
ATAAAAAAAAGTAAAATAATTAAAACAAAGAAGGATATGATTCTATTAAAAGGTAGGAGA
CTGCTCCTTATAACAAAAACTAAACTGAGGAAGAAAACTCTGAAGAAAAAGTTAAAGATA
TAATGACTGAAAAATATGAAAACTTTTGGGATAAATTCAAAGAAATGGGTATCTTAGAAA
GATTATTAATACTTACTGAAATACCTATTGATGTTGCTAGATATTTAATTATCCCTCCTG
CCGAGGAGAATTAATGGAATAAATGGAGGGCTATGATAACAACAATAACAGGACCTCTTG
CCTTTATGTGGGGCTCATAATAAAGTAATATTTAGCTCAAAATTTTTTAAAATGTGATTA
GATTGATTTGTTTGTTTTATTTTATTTTATTTTACTTTGAAAGGTGGAGTATTTGTTTAT
TAAAAAATCCATCTAAATCTAATTTTTTAAGATTTTTATTTGAATGAAAACTTGATTTTA
AATATTTAAAATATTTATTTGAAATTAGATTTAAATGCCACTATCAATGATGAAGGGTTT
TTGGTGATATATATAGTACTAATAATTTCGTTTATTGCATCAATATTGATATTCTTCTTT
ACTAAAAATAACTAACCTCCTCAAATAATGTGGCTATTTTCTATATTTTCATTTGTTGTT
GCAGTTGTTTTACTTGGCTAAGCTGCTTAAGTTATGATTGATTTTATTAATGTAAATGAA
AAAGATTGAAAAAAATAATCTAAAATATTTTTTACTATTCAACTAGTTTTTCTAAATTGT
GACAAATATGAATAAGACATTTTTGGGTATGACCGTTTTAGCTTGGGGAAACTCAGCAAC
TGGTAATTATAATTTATGATTTATTAAAATTTTTGAAATTATAATTAAATAAAATTAGAC
TTTTTCCTTAACTCCAGTCTTGCTTCAATAGGATATGGAGTTATGGCTGCTACTGGGTGC
TTTGCAGGCTAAGCCTTTGATCTTTACTTAGGTTTTGGAATTGCATTGATTTTCTATTCA
AATTAATCTAATAGCAGTTTATCAATTTTTACTGGATCTAGTACCCTTGATTGGATTAAC
AATTCTATTGCTATTAGTGTTATCTTATTTGTTATTATATCTTCAGCAATATCTATAATA
GTTGGTTTAAAGCTAAAGTAAATAAAAAATTTATTCCTTTTTTTCATTGATAAAATTATT
ATAAATAAAGGTTTAGTTATGATTAAGGTAAATACACGACTTTTCTTAAATATTACTACT
TATGTGCCTTAACCTTCTGTATAATCTTATGTGCTGCAGATTAATTTTACGAATGA