Identifiers and Description

Gene Model Identifier

TTHERM_00068170

Standard Name

TCB2 (Tetrahymena Calcium-Binding 2 )

Aliases

4.m00605 | PreTt13206 | TCBP-25 | 3707.m00242

Description

25 kD Ca(2+)-binding protein containing four EF-hand loops; localized to cell cortex except in and around basal bodies, and around both the migratory and stationary gametic pronuclei during pronuclear exchange stage of conjugation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 27.8%

TetraMine Data

TTHERM_00068170

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02114.11.0003491030231826e-151EF hand family protein (219 aa
)
OxytrichaContig13881.0.g740.0000020007268868677913EF-hand domain pair
DictyBaseDDB_G02870090.00003998524687536623mcfC on chromosome: 4 position
5197882 to 5199603
WormBaseWBGene000068610.00010003404299092957locus:cal-5 status:Confirmed
UniProt:Q18136 protein_id
:CCD65556.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:10503211: Numata O, Hanyu K, Takeda T, Watanabe Y (2000) Tetrahymena calcium-binding proteins, TCBP-25 and TCBP-23. Methods in cell biology 62( ):455-65
  2. Ref:7641801: Hanyu K, Takemasa T, Numata O, Takahashi M, Watanabe Y (1995) Immunofluorescence localization of a 25-kDa Tetrahymena EF-hand Ca(2+)-binding protein, TCBP-25, in the cell cortex and possible involvement in conjugation. Experimental cell research 219(2):487-93
  3. Ref:1880125: Kimura M, Hirono M, Takemasa T, Watanabe Y (1991) Drastic change in the level of actin mRNA in the course of synchronous division in Tetrahymena. Journal of biochemistry 109(3):399-403
  4. Ref:2303413: Takemasa T, Takagi T, Kobayashi T, Konishi K, Watanabe Y (1990) The third calmodulin family protein in Tetrahymena. Cloning of the cDNA for Tetrahymena calcium-binding protein of 23 kDa (TCBP-23). The Journal of biological chemistry 265(5):2514-7
  5. Ref:2808424: Takemasa T, Ohnishi K, Kobayashi T, Takagi T, Konishi K, Watanabe Y (1989) Cloning and sequencing of the gene for Tetrahymena calcium-binding 25-kDa protein (TCBP-25). The Journal of biological chemistry 264(32):19293-301
  6. Ref:SUPR000053

Sequences

>TTHERM_00068170(coding)
ATGAAATAAATAAATAAAAACTTTAAATAGATATGCGTGATTGCTTTAATAATTTAATTT
AATAAATTACGAATTATCTTCTTTTTATTACTTGTTTATTTTCAAGTATCTCATTCAGAA
CGATTTAAATAAAAACTTAAATAAAAAATTATTTATAATCTTTAAAGCAAAAAAAAATTA
ATTAAATAAAATTCAAAAAACAACAAACAAACAATAAATAAATAAATGGCTCAATACTCT
CAAACTCTCAGATCTTCTGGTTTCACTTCCACTGTTGGTCTCACCGATATTGAAGGTGCT
AAGACTGTCGCTAGAAGAATCTTCGAAAACTACGACAAGGGCAGAAAGGGCAGAATCGAA
AACACCGACTGTGTTCCCATGATTACTGAAGCCTACAAGTCCTTCAACTCCTTCTTTGCC
CCCTCTTCTGATGACATCAAGGCCTACCACAGAGTCCTCGACAGAAACGGTGACGGTATT
GTTACTTACTAAGATATTGAAGAACTTTGCATCAGATACCTCACTGGTACCACTGTCTAA
AGAACTATCGTCACTGAAGAAAAGGTTAAGAAGTCCAGCAAGCCCAAATACAACCCTGAA
GTTGAAGCTAAGCTCGACGTCGCTAGAAGACTCTTCAAGAGATACGACAAGGACGGTTCT
GGTTAATTACAAGATGACGAAATCGCTGGCTTATTAAAGGACACCTATGCTGAAATGGGT
ATGTCCAACTTCACCCCTACTAAGGAAGACGTTAAGATCTGGTTATAAATGGCTGACACC
AACTCTGATGGTTCAGTCTCCCTTGAAGAATACGAAGACCTCATTATCAAGTCTCTCCAA
AAGGCTGGTATTAGAGTCGAAAAGTAATCCTTAGTTTTCTGA


>TTHERM_00068170(protein)
MKQINKNFKQICVIALIIQFNKLRIIFFLLLVYFQVSHSERFKQKLKQKIIYNLQSKKKL
IKQNSKNNKQTINKQMAQYSQTLRSSGFTSTVGLTDIEGAKTVARRIFENYDKGRKGRIE
NTDCVPMITEAYKSFNSFFAPSSDDIKAYHRVLDRNGDGIVTYQDIEELCIRYLTGTTVQ
RTIVTEEKVKKSSKPKYNPEVEAKLDVARRLFKRYDKDGSGQLQDDEIAGLLKDTYAEMG
MSNFTPTKEDVKIWLQMADTNSDGSVSLEEYEDLIIKSLQKAGIRVEKQSLVF


>TTHERM_00068170(gene)
ATGAAATAAATAAATAAAAACTTTAAATAGATATGCGTGATTGCTTTAATAATTTAATTT
AATAAATTACGAATTATCTTCTTTTTATTACTTGTTTATTTTCAAGTATCTCATTCAGAA
CGATTTAAATAAAAACTTAAATAAAAAATTATTTATAATCTTTAAAGCAAAAAAAAATTA
ATTAAATAAAATTCAAAAAACAACAAACAAACAATAAATAAATAAATGGCTCAATACTCT
CAAACTCTCAGATCTTCTGGTTTCACTTCCACTGTTGGTCTCACCGATATTGAAGTAAAT
ACTCCCACCATTCAAAACAATTATATCCCTTAGCCTACAGTCTTTCAGGTTATTAACTCT
CACTAATATCATCTACCACACATCGATATCAATCATCACGAACTGATGCTGATTTTACTT
GAGCCAGTGAAAAGAAATTTGATGGTTTTGTAAAAGGAAGCAAATAGAGCATGTTATAGA
GTAAAAGAATATAAATAAAGAAGTAAGTTATCAACCATATTTACTAGAATGAATAAAACG
AAATGGTATTTAGCCTTTAAAAGATAGCAAAAAAATTTTGAAGATACACTTTAAAAAGCT
TGGTACCATATAAAATAAATCAAGTCAGCAAGTATAAATACAAGCAAAAATTAACAAAAA
ATAAATAAATAAACTTACTTCTTCTTTTTATGATAACTCTTGATTCTTATCTAGCATCAA
AACAATATGAAATCAATTTACTTAAGAAGCAGAGGCTCTAGATACAGATCAGATATGAAC
AAAAGCGGTATTGAGTTAGCTAGTTGATGAGTTAGTGATCAAAAGACTTTGGCTATAATT
ATTTGACAAACATTTTTTCTTATAATCTAATTAATCTTTTCTAATAGGGTGCTAAGACTG
TCGCTAGAAGAATCTTCGAAAACTACGACAAGGGCAGAAAGGGCAGAATCGAAAACACCG
ACTGTGTTCCCATGATTACTGAAGCCTACAAGTCCTTCAACTCCTTCTTTGCCCCCTCTT
CTGATGACATCAAGGCCTACCACAGAGTCCTCGACAGAAACGGTGACGGTATTGTTACTT
ACTAAGATATTGAAGAACTTTGCATCAGATACCTCACTGGTACCACTGTCTAAAGAACTA
TCGTCACTGAAGAAAAGGTTAAGAAGTCCAGCAAGCCCAAATACAACCCTGAAGTTGAAG
CTAAGCTCGACGTCGTAAGAAATAAATACATTTTATTCTTTTTTAGAACTTATAAAAAAT
TTTAAAACGTAATTTTAAAATATCTTTTTAAATTAAAATAGGCTAGAAGACTCTTCAAGA
GATACGACAAGGACGGTTCTGGTTAATTACAAGATGACGAAATCGCTGGCTTATTAAAGG
ACACCTATGCTGAAATGGGTATGTCCAACTTCACCCCTACTAAGGAAGACGTTAAGATCT
GGTTATAAATGGCTGACACCAACTCTGATGGTTCAGTCTCCCTTGAAGAATACGAAGACC
TCATTATCAAGTCTCTCCAAAAGGCTGGTATTAGAGTCGAAAAGTAATCCTTAGTTTTCT
GA