Identifiers and Description

Gene Model Identifier

TTHERM_00495950

Standard Name

TCB1 (Tetrahymena Calcium-Binding protein )

Aliases

PreTt06860 | 62.m00144 | TCBP-23 | 3715.m00006

Description

23 kD EF-hand containing Ca(2+)-binding protein; localized to cell cortex, except for the oral apparatus and around the basal bodies; likely associated with the epiplasm

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00495950

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12786.12.0006597401342834e-129EF hand family protein (207 aa
)
OxytrichaContig605.1.g930.000000000800327577657144EF hand
WormBaseWBGene000009600.00000030014504373857585locus:dgk-3 Probable diacylg
lycerol kinase 3 status:Part
ially_confirmed UniProt:Q036
03 protein_id:CAA79558.3
DictyBaseDDB_G02870090.00003998524687536623mcfC on chromosome: 4 position
5197882 to 5199603
SGDYBR109C0.00020003864201578029CMD1 Calmodulin; Ca++ binding
protein that regulates Ca++ in
dependent processes (mitosis,
bud growth, actin organization
, endocytosis, etc.) and Ca++
dependent processes (stress-ac
tivated pathways), targets inc
lude Nuf1p, Myo2p and calcineu
rin

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:10503211: Numata O, Hanyu K, Takeda T, Watanabe Y (2000) Tetrahymena calcium-binding proteins, TCBP-25 and TCBP-23. Methods in cell biology 62( ):455-65
  2. Ref:8797091: Hanyu K, Numata O, Takahashi M, Watanabe Y (1996) Immunofluorescence localization of a 23-kDa Tetrahymena calcium-binding protein, TCBP-23, in the cell cortex. Journal of biochemistry 119(5):914-9
  3. Ref:2303413: Takemasa T, Takagi T, Kobayashi T, Konishi K, Watanabe Y (1990) The third calmodulin family protein in Tetrahymena. Cloning of the cDNA for Tetrahymena calcium-binding protein of 23 kDa (TCBP-23). The Journal of biological chemistry 265(5):2514-7

Sequences

>TTHERM_00495950(coding)
ATGGAACACCAAATCATCACCTAAAACGTCTACGCTCCTGATACTGAAGCCAAGCTTGAT
GTTGCTAGAAAGCTTTTTGCTTAGTTTGATTCTAACAAGAACGGTACTTTAGATCCTAGC
GAAGTTGCTGGACTCATCAAGACTACTTTTGAAAATATGGGTGTTAAGGACTACAGCGTC
ACTGCTGATGATGTCAAGCTTTACATGAAGAGTGTTGATGTTGATAACAACGGTCTTGTT
TCCTACTCTGAATACGAAGAATACGTCATTGCTTGCCTCAAGAAAGCTGGCTTCGACTGT
GAAGTTAAGGAAAAGGTAAAAAGATCTGCCAAAAAGAGAGACGCTGCTACTGAAATGAAG
TTGGACGTTGCCAGAAGACTCTTCGCTAAGTACGACTCTGATAAGAGTGGTTAATTAGAA
GAAAAGGAAGTTTATGGTGTCATTACTGAAACCTATAAGCAAATGGGTATGGATTACAAG
CCCACTGAAGCTGATGTTAAGCTTTGGATGTCCATGACTGATACTGATAAGAATGGAACT
GTCTCTATTGTTGAATATGAAGATTTCGTCATTTCTGGTCTTAAGAAGGCTGGTTTCATG
GTCAAGGAATTCACTCAAGCTTGA


>TTHERM_00495950(protein)
MEHQIITQNVYAPDTEAKLDVARKLFAQFDSNKNGTLDPSEVAGLIKTTFENMGVKDYSV
TADDVKLYMKSVDVDNNGLVSYSEYEEYVIACLKKAGFDCEVKEKVKRSAKKRDAATEMK
LDVARRLFAKYDSDKSGQLEEKEVYGVITETYKQMGMDYKPTEADVKLWMSMTDTDKNGT
VSIVEYEDFVISGLKKAGFMVKEFTQA


>TTHERM_00495950(gene)
ATGGAACACCAAATCATCACCTAAAACGTCTACGCTCCTGATACTGAAGCCAAGCTTGAT
GTTGCTAGAAAGCTTTTTGCTTAGTTTGATTCTAACAAGAACGGTACTTTAGATCCTAGC
GAAGTTGCTGGACTCATCAAGACTACTTTTGAAAATATGGGTGTTAAGGACTACAGCGTC
ACTGCTGATGATGTCAAGCTTTACATGAAGAGTGTTGATGTTGATAACAACGGTCTTGTT
TCCTACTCTGAATACGAAGAATACGTCATTGCTTGCCTCAAGAAAGCTGGCTTCGACTGT
GAAGTTAAGGAAAAGGTAAAAAGATCTGCCAAAAAGAGAGACGCTGCTACTGAAATGAAG
TTGGACGTTGCCAGAAGACTCTTCGCTAAGTACGACTCTGATAAGAGTGGTTAATTAGAA
GAAAAGGAAGTTTATGGTGTCATTACTGAAACCTATAAGCAAATGGGTATGGATTACAAG
CCCACTGAAGCTGATGTTAAGCTTTGGATGTCCATGACTGATACTGATAAGAATGGAACT
GTCTCTATTGTTGAATATGAAGATTTCGTCATTTCTGGTCTTAAGAAGGCTGGTTTCATG
GTCAAGGAATTCACTCAAGCTTGA