Identifiers and Description

Gene Model Identifier

TTHERM_00470500

Standard Name

TBS2 (Fusion of SEC7-family GTPase and TBC1 domain GTPase activator)

Aliases

PreTt22464 | 56.m00168 | 3686.m00011

Description

Fusion of SEC7-family GTPase and TBC1 domain GTPase activator

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

  • ARF guanyl-nucleotide exchange factor activity (IEA) | GO:0005086

Biological Process

  • regulation of ARF protein signal transduction (IEA) | GO:0032012

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 15.6%

TetraMine Data

TTHERM_00470500

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11393.19.997093137033517e-262Sec7 domain-containing protein
(1182 aa)
OxytrichaContig17452.0.g485.0012639607461234e-61Sec7 domain
DictyBaseDDB_G02792411.999981404597394e-31DDB_G0279241 on chromosome: 3
position 1814829 to 1818189
SGDYDR170C3.99801309251602e-27SEC7 Guanine nucleotide exchan
ge factor (GEF) for ADP ribosy
lation factors involved in pro
liferation of the Golgi, intra
-Golgi transport and ER-to-Gol
gi transport; found in the cyt
oplasm and on Golgi-associated
coated vesicles
WormBaseWBGene000123867.996806159126539e-24locus:agef-1 status:Partiall
y_confirmed UniProt:G5EFH7
protein_id:CAA21704.3
Stentor CoeruleusSteCoe_94240.000000000000012664165549094176

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00470500(coding)
ATGGTGATAATTTTGAGATTTTAGGTAATAATTCTAAAATATACTATTGAATTGGTTTAT
TTTGATTTGAAATTTATTATAGAAGATACTTTCTTTTTAATTTTCTATCTATCTATCAAA
AATTAACATTAGAGTTACTTATTAAAATTTAAGAAACAAAAATTAACTTAATTTCTAATT
TTTGTTATATTACACTTAAAGCAGATGAGCTAACCACAATTGGAATAAGACAAAAGAATT
TAGGAAATACATATAAACTAACATGAGTATGGTAATAAAAATTAGATTGAAGAAAAGTAA
GTACCTTTTTGGTTAATAAATTGTCAGGCAACATCTTCAAGGCAAGTTTTAAGTCACCAA
AATATTGCTGAACCCAATCCTGAATAATCACAGAATCACTAAAACAGCCAGGAGTATGAA
TAACCATCATTCCCTTCTAGATAAATCGATTTAATAGAGGTTGATGAAAATTCAAATTTT
GATAGTAAAAATGCTCACGTTTAAAGTAAATAAATCGAACACATTTAAGATAAAGCTATG
ACCCCTTAAAAGCAGGCTTAAGCATTTGATGATATATTATTGGATCTTATAGTTCCTTCA
GAGAGATCTATAAATTAAAATTAAAAAAAATATGACTTATAAACATAAGAATATGCTATA
AATTAATGGAATTGTGTAATGAGTACCTAATAAAATATTTCTTTGAATAAATAAAATAAA
GATTAGGATGAACTTAAAGATGAGTAAAACTTAAAAGATCAAATTTAGAAAGAATGGAGT
AATTCTAATTAGAATTCAAATGATTAACAATAAATTTAATAGTAAATAAATGGTGACACC
TTTTTTGATTTAAAAGAATTCAACAAATAGTTCAATGATTTAAAAGAAACGAATGATTTC
AGCGAGTAAAATATAAAGTCTGATGAAAATAAAATGAATAATATTCCATAATAGAGTTAA
TAGTACCTAAATAGAAATTAATTTGACATAGATGAGAAAGATTAATTTGATATAGAAGAT
AAAAATGAATAAGGCTTTACTTTGATAACAAAAAACTAAAATAAATAATTGATAGAATCA
AATGATAATCCTTAGAACATAAACGAAGATTTGTATATAAACGAAAACTTTAACAATCTA
ATTGAAACTATAGATGAATAGGAATTTGAACAAAAATAATAAAGTAGGTACAAATAAAGA
TATTATAGCGAATATACTCATGTAGATAATGCTTTACTATAACCAACATAAGGATTATAT
GATATTTGTGACAATATAAATGAAAATGAAAATGATTCTAAATAACTTAACTAAAAATAA
AAAAAAATGTAATTACTACACAACTAATCATCAAAAGATATGTTTCAATCGGCATAAAAT
GGGTTTAAAAATAATAGACTGAGTCATAATGTCTAGCTTTCCACGAATGTACCAGATCCA
TTAGATTTTTACTCTCACAGACCACCTACAGGATATTTCACTCTGAAAAGAGGTGTCACA
GGAGTTTCTCAAGTAGTAGATCTTTTGCAAGAAGCCAATATTCTGAAGGAAGAGCAAAAA
AAGTAGTTAAAGAGAGATTAATTTATGATTGAGTTTAATACAGATCCCAACTCAGCTATC
TAAAAATTAGAGTAAGACTAAAAACTCAGTCTATAAAATATAGCAGAATTTTTGTTGAAG
GCTGAAGGAATAAGAAAAAATACTCTTGGATAATTTTTTGGGAAAGAAACATAAAAAAAT
CAAGATATTTTAAGAGAGTTCTGTAAAATCATCGATTTCAATAATTAAACGATTGATGAA
GCTTTGAGGTCTTTGATGAGTAAATTCAGACTTCCAGGAGAATCTTAATAAATAGACAGA
ATAATGTGTGCTTTTTCTGAATCATATCATGAGCAAAATCCGAATACTTTTGAAAATTCT
GACATCGTTTACATTTTAGCCTATTCTATAATAATGCTACACACAGATATCCACTCTGAC
AAAATAGAAAAAAAAGATAAGATGAAAAGATAAGATTATGTTGAGAGAACAATAAATGTT
ACAAAAAGTAAAACAGTTACTTTTAAAGTACTTTCTGAAATATATGATAGGATATAAGCA
AAATAATTTGAATGTGAGTAAGATGCTTTTGAGAAGGCATATGACATTCTACTTATATCT
CATGCAGATAATCAAACAGATTTTTCTAAGCTTCTTAATAAAGATATTAAAATATTTTAG
AATGGAAGTTTATTTTTAAAATATGGAAGATCAGGTAGTCCTAAGGAAAAATTTGTAAAT
CTATCTGAATCTGGAGATAAAATTCAATGGTGTGACCCTAAAAATAAAAGTAAGAAAAGA
GAAATCTTAATAGATGATATATATGAAATAACAATTGGGAGTGATAAAACTGAAGTACTT
AGAAAAAATAAAGTTCCTAAGCAGTTTGATAATTTATGCTTCTCTTTACTTGTAATAGGA
CATGACAATGGTAAAAGAAGTCTTGACCTAAAAGCGAAAGATGAGGATTAAAGAAATAAA
TGGGTTCGTTTTTGCTACTAAAGACTACTTTTTGCTAAGTAGCAAGCATTCGAATTCAAA
AAGGCTAAATTTAGTATGTAAGAATACAAAGAAGAAATAGCTGGAATTTGGAAGAGCTAA
ATTTTTGAATAGTTTGATAAATTTTGGGATTATGAAAAAAATTTACCTCTTAATATGGAT
AAGTTTTACAAGTTTAAAAGCAAAAGTAAAGAAAATAGCAAAAACTTATGGAAGAATGTA
ATGAAAAAGAAAAAGCAATAAACATAAAGATATTCTTAAGTTGGAATTTTTAATGAAAGC
GAAATGATAAGAGAACACATAGAAGATTTGCAAAAAGACAAAGAAATACTATTCATTAGA
TTATGGAAATAGGGACTACCTCATTTTGTTAGAAAGACTCTATATAAGCTATCTATTGGA
AACAGTTTATAAATAACTCACTAATATTATTTAATTGTCAAGCAATAAGCTGAATAAAGT
ATTTTTAAATAAAGTAATAATAATAACAATAAGTTTGCTCAGTCAGAGATAATTAGATAA
TCAGGCTTAGGGTCTCCTAGAATGAGGGAGTACTCTCTTTTTGATAAAATTTAATAGATG
GAAGCAGATATGGTTGAGTTTTTAGAGAAAAATCCCATCTTCAAACCTAATCATGAAATG
ATATAAAACGTATTAAAATATACATTGTACGTTCGCTAGGATTTGAACTACCTAAACTAT
ATGATAAATATTGCAGCCTTAATTGTGAACGTTTTCTAAAATGAAAGTGATTCATTTATA
TATTTCATTAATTTGATTTATAGCTATCACTTTAAGCCCTTATATAGTGGTGATAAAATC
AAAATTGAGTTTTACAATTAGTTCTTTTATCAAAGCTTCTAAAAAGAGATGAAAGATTTA
CATGAGAGATTCATAGGTTTAAACTTAGGGCCCTAAAATTATCTCTATAGTTGGATGCTC
TCACTATTTTCAAATTATTTTTAAGATGTCAATATAGTATATAGAATTTTAGATAATGTT
CTAATAGAAGGTGAGTATTATATTTTTAAAGCAGCACTAGGTATTATAAAAATGTTTGAA
ATAGATCTCAGGTTTTCATCTTTTACTATAGCCTTCAAATTTTTAACTGAAACATCTAAA
AACGTAAATGAAGAGTTTCTATTTGATACCATAGAATGCATCGATATAAATAAGTAAGAT
TATGAAAAATTTTTCACTGATTTAAAGAAATCGCAAGCTAAATCACTAATACATGAAATA
TTAGTAGAATTGTGA


>TTHERM_00470500(protein)
MVIILRFQVIILKYTIELVYFDLKFIIEDTFFLIFYLSIKNQHQSYLLKFKKQKLTQFLI
FVILHLKQMSQPQLEQDKRIQEIHINQHEYGNKNQIEEKQVPFWLINCQATSSRQVLSHQ
NIAEPNPEQSQNHQNSQEYEQPSFPSRQIDLIEVDENSNFDSKNAHVQSKQIEHIQDKAM
TPQKQAQAFDDILLDLIVPSERSINQNQKKYDLQTQEYAINQWNCVMSTQQNISLNKQNK
DQDELKDEQNLKDQIQKEWSNSNQNSNDQQQIQQQINGDTFFDLKEFNKQFNDLKETNDF
SEQNIKSDENKMNNIPQQSQQYLNRNQFDIDEKDQFDIEDKNEQGFTLITKNQNKQLIES
NDNPQNINEDLYINENFNNLIETIDEQEFEQKQQSRYKQRYYSEYTHVDNALLQPTQGLY
DICDNINENENDSKQLNQKQKKMQLLHNQSSKDMFQSAQNGFKNNRLSHNVQLSTNVPDP
LDFYSHRPPTGYFTLKRGVTGVSQVVDLLQEANILKEEQKKQLKRDQFMIEFNTDPNSAI
QKLEQDQKLSLQNIAEFLLKAEGIRKNTLGQFFGKETQKNQDILREFCKIIDFNNQTIDE
ALRSLMSKFRLPGESQQIDRIMCAFSESYHEQNPNTFENSDIVYILAYSIIMLHTDIHSD
KIEKKDKMKRQDYVERTINVTKSKTVTFKVLSEIYDRIQAKQFECEQDAFEKAYDILLIS
HADNQTDFSKLLNKDIKIFQNGSLFLKYGRSGSPKEKFVNLSESGDKIQWCDPKNKSKKR
EILIDDIYEITIGSDKTEVLRKNKVPKQFDNLCFSLLVIGHDNGKRSLDLKAKDEDQRNK
WVRFCYQRLLFAKQQAFEFKKAKFSMQEYKEEIAGIWKSQIFEQFDKFWDYEKNLPLNMD
KFYKFKSKSKENSKNLWKNVMKKKKQQTQRYSQVGIFNESEMIREHIEDLQKDKEILFIR
LWKQGLPHFVRKTLYKLSIGNSLQITHQYYLIVKQQAEQSIFKQSNNNNNKFAQSEIIRQ
SGLGSPRMREYSLFDKIQQMEADMVEFLEKNPIFKPNHEMIQNVLKYTLYVRQDLNYLNY
MINIAALIVNVFQNESDSFIYFINLIYSYHFKPLYSGDKIKIEFYNQFFYQSFQKEMKDL
HERFIGLNLGPQNYLYSWMLSLFSNYFQDVNIVYRILDNVLIEGEYYIFKAALGIIKMFE
IDLRFSSFTIAFKFLTETSKNVNEEFLFDTIECIDINKQDYEKFFTDLKKSQAKSLIHEI
LVEL


>TTHERM_00470500(gene)
ATGGTGATAATTTTGAGATTTTAGGTAATAATTCTAAAATATACTATTGAATTGGTTTAT
TTTGATTTGAAATTTATTATAGAAGATACTTTCTTTTTAATTTTCTATCTATCTATCAAA
AATTAACATTAGAGTTACTTATTAAAATTTAAGAAACAAAAATTAACTTAATTTCTAATT
TTTGTTATATTACACTTAAAGCAGATGAGCTAACCACGTACTCAATTAGTTTTCTTTGAG
AATAATTATTAACTGTTTGTTCATAACATGGAAATTTTTTTATAAAATATTTTTAGAATT
GGAATAAGACAAAAGAATTTAGGAAATACATATAAACTAACATGGTAAATAAAATATACA
ATATACTTTATGTTTTTAATCATCAAGACCTCTAAAAGAAATATTTTTAAATATAAATTT
TACTAGAGTATGGTAATAAAAATTAGATTGAAGAAAAGTAAGTACCTTTTTGGTTAATAA
ATTGTCAGGCAACATCTTCAAGGCAAGTTTTAAGTCACCAAAATATTGCTGAACGTAAAT
AATCTTTAGAAATAAGCAAAGTAGTAATAAAATAATTCGTTTATAATTAGCCAATCCTGA
ATAATCACAGAATCACTAAAACAGCCAGGAGTATGAATAACCATCATTCCCTTCTAGATA
GTAAAATTAAAAATTTTTTTATCATGAATTAATAAAGGATGAAAATTTATTTTAAAAAAG
AATCGATTTAATAGAGGTTGATGAAAATTCAAATTTTGATAGTAAAAATGCTCACGTTTA
AAGTAAATAAATCGAACACATTTAAGATAAAGCTATGACCCCTTAAAAGCAGGCTTAAGC
ATTTGATGATATATTATTGGATCTTATAGTTCCTTCAGAGAGATCTATAAATTAAAATTA
AAAAAAATATGACTTATAAACATAAGAATATGCTATAAATTAATGGAATTGTGTAATGAG
TACCTAATAAAATATTTCTTTGAATAAATAAAATAAAGATTAGGATGAACTTAAAGATGA
GTAAAACTTAAAAGATCAAATTTAGAAAGAATGGAGTAATTCTAATTAGAATTCAAATGA
TTAACAATAAATTTAATAGTAAATAAATGGTGACACCTTTTTTGATTTAAAAGAATTCAA
CAAATAGTTCAATGATTTAAAAGAAACGAATGATTTCAGCGAGTAAAATATAAAGTCTGA
TGAAAATAAAATGAATAATATTCCATAATAGAGTTAATAGTACCTAAATAGAAATTAATT
TGACATAGATGAGAAAGATTAATTTGATATAGAAGATAAAAATGAATAAGGCTTTACTTT
GATAACAAAAAACTAAAATAAATAATTGATAGAATCAAATGATAATCCTTAGAACATAAA
CGAAGATTTGTATATAAACGAAAACTTTAACAATCTAATTGAAACTATAGATGAATAGGA
ATTTGAACAAAAATAATAAAGTAGGTACAAATAAAGATATTATAGCGAATATACTCATGT
AGATAATGCTTTACTATAACCAACATAAGGATTATATGATATTTGTGACAATATAAATGA
AAATGAAAATGATTCTAAATAACTTAACTAAAAATAAAAAAAAATGTAATTACTACACAA
CTAATCATCAAAAGATATGTTTCAATCGGCATAAAATGGGTTTAAAAATAATAGACTGAG
TCATAATGTCTAGCTTTCCACGAATGTACCAGATCCATTAGATTTTTACTCTCACAGACC
AGTAATTTGATCATATATTAATAAAAAGGCTTGAAATTTAAATTTTTTTTCTTCAGCCTA
CAGGATATTTCACTCTGAAAAGAGGTGTCACAGGAGTTTCTCAAGTAGTAGATCTTTTGC
AAGAAGCCAATATTCTGAAGGAAGAGCAAAAAAAGTAGTTAAAGAGAGATTAATTTATGA
TTGAGTTTAATACAGATCCCAACTCAGCTATCTAAAAATTAGAGTAAGACTAAAAACTCA
GTCTATAAAATATAGCAGAATTTTTGTTGAAGGCTGAAGGAATAAGAAAAAATACTCTTG
GATAATTTTTTGGGTATATATATTTCTATATAAATAAATAATATTTATTAATCAATCTTG
AAAATGTTAAACAGGAAAGAAACATAAAAAAATCAAGATATTTTAAGAGAGTTCTGTAAA
ATCATCGATTTCAATAATTAAACGATTGATGAAGCTTTGAGGTATTAATTTTATCATGGC
TTATTAAAAAATTTATTTTAATTGATTAATAATTTGATAGGTCTTTGATGAGTAAATTCA
GACTTCCAGGAGAATCTTAATAAATAGACAGAATAATGTGTGCTTTTTCTGAATCATATC
ATGAGCAAAATCCGAATACTTTTGAAAATTCTGACATCGTTTACATTTTAGCCTATTCTA
TAATAATGCTACACACAGATATCCACTCTGACAAAATAGAAAAAAAAGATAAGATGAAAA
GATAAGATTATGTTGAGAGAACAATAAATGTTACAAAAAGTAAAACAGTTACTTTTAAAG
TACTTTCTGAAATATATGATAGGATATAAGCAAAATAATTTGAATGTGAGTAAGATGGTA
AATTATTACAGTTTTATATATTTAAGTTATATCAAAATAATAATCTTAATTAGCTTTTGA
GAAGGCATATGACATTCTACTTATATCTCATGCAGATAATCAAACAGATTTTTCTAAGCT
TCTTAATAAAGATATTAAAATATTTTAGAATGGAAGTTTATTTTTAAAATATGGAAGATC
AGGTAGTCCTAAGGAAAAATTTGTAAATCTATCTGAATCTGGAGATAAAATTCAATGGTG
TGACCCTAAAAATAAAAGTAAGAAAAGAGAAATCTTAATAGATGATGTAATTAATTAACA
TAAATTTATTTTGGTTGTTATAATAAATTTAATTTAAAATATAATTATAAGATATATGAA
ATAACAATTGGGAGTGATAAAACTGAAGTACTTAGAAAAAATAAAGTTCCTAAGCAGTTT
GATAATTTATGCTTCTCTTTACTTGTAATAGGACATGACAATGGTAAAAGAAGTCTTGAC
CTAAAAGCGAAAGATGAGGATTAAAGAAATAAATGGGTTCGTTTTTGCTACTAAAGACTA
CTTTTTGCTAAGTAGCAAGCATTCGAATTCAAAAAGGCTAAATTTAGTATGTAAGAATAC
AAAGAAGAAATAGCTGGAATTTGGAAGAGCTAAATTTTTGAATAGTTTGATAAATTTTGG
GATTATGAAAAAAATTTACCTCTTAATATGGATAAGTTTTACAAGTTTAAAAGCAAAAGT
AAAGAAAATAGCAAAAACTTATGGAAGAATGTAATGAAAAAGAAAAAGCAATAAACATAA
AGATATTCTTAAGTTGGAATTTTTAATGAAAGCGAAATGATAAGAGAACACATAGAAGAT
TTGCAAAAAGACAAAGAAATACTATTCATTAGATTATGGAAATAGGGACTACCTCATTTT
GTTAGAAAGACTCTATATAAGCTATCTATTGGAAACAGTTTATAAATAACTCACTAATAT
TATTTAATTGTCAAGCAATAAGCTGAATAAAGTATTTTTAAATAAAGTAATAATAATAAC
AATAAGTTTGCTCAGTCAGAGATAATTAGATAATCAGGCTTAGGGTCTCCTAGAATGAGG
GAGTACTCTCTTTTTGATAAAATTTAATAGATGGAAGCAGATATGGTTGAGTTTTTAGAG
AAAAATCCCATCTTCAAACCTAATCATGAAGTAATTAATTTGCTATTATTTAAATTTCAT
TTGAGTATTAAGTTTTTTGAATTTTTTAAGAAAAACAAAAAAATTTCTTTAAATAAGCAC
TAAATAAAAAATTTAAAGCTAGATTTTGATATTTTAATAATAAATTATTCATTAAAATTA
ATTAGATGATATAAAACGTATTAAAATATACATTGTACGTTCGCTAGGATTTGAACTACC
TAAACTATATGATAAATATTGCAGCCTTAATTGTGAACGTTTTCTAAAATGAAAGTGATT
CATTTATATATTTCATTAATTTGATTTATAGCTATCACTTTAAGCCCTTATATAGTGGTG
ATAAAATCAAAGTAAAACAATTTAAATTTATCATCATATTTTAATTAACTATATGCTAAT
TTTAAATAAACATTTTAGATTGAGTTTTACAATTAGTTCTTTTATCAAAGCTTCTAAAAA
GAGATGAAAGATTTACATGAGAGATTCATAGGTTTAAACTTAGGGCCCTAAAATTATCTC
TATAGTTGGATGCTCTCACTATTTTCAAATTATTTTTAAGATGTCAATATAGTATATAGA
ATTTTAGATAATGTTCTAATAGAAGGTGAGTATTATATTTTTAAAGCAGCACTAGGTATT
ATAAAAATGTTTGAAATAGATCTCAGGTTTTCATCTTTTACTATAGCCTTCAAATTTTTA
ACTGAAACATCTAAAAACGTAAATGAAGAGTTTCTATTTGATACCATAGAATGCATCGAT
GTAATAATTCCATTTTATTATTAATTAATAAATACATTTTTTATTATTTTATAAAAGATA
AATAAGTAAGATTATGAAAAATTTTTCACTGATTTAAAGAAATCGCAAGCTAAATCACTA
ATACATGAAATATTAGTAGAATTGTGA