Identifiers and Description

Gene Model Identifier

TTHERM_00402039

Standard Name

TBS1 (Fusion of SEC7-family GTPase and TBC1 domain GTPase activator)

Aliases

3713.m01023

Description

Fusion of SEC7-family GTPase and TBC1 domain GTPase activator

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.8%

TetraMine Data

TTHERM_00402039

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13981.19.997093137033517e-262hypothetical protein (1495 aa)
OxytrichaContig17452.0.g482.0009803861620222e-78Sec7 domain
DictyBaseDDB_G02792416.0018235484001396e-36DDB_G0279241 on chromosome: 3
position 1814829 to 1818189
WormBaseWBGene000440617.001594317853847e-31locus:tbc-12 status:Partiall
y_confirmed UniProt:Q21928
protein_id:CCD71667.1
SGDYDR170C2.0008113830639685e-30SEC7 Guanine nucleotide exchan
ge factor (GEF) for ADP ribosy
lation factors involved in pro
liferation of the Golgi, intra
-Golgi transport and ER-to-Gol
gi transport; found in the cyt
oplasm and on Golgi-associated
coated vesicles
Stentor CoeruleusSteCoe_94240.00000000000003442477108469977

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00402039(protein)
MNNPEQYGSVKKKLANISSFQAGPQALVQDPQIQQAKSDHAAPSAYSTSQFSTTSMRDGS
NMIYQNGNIQQSNQYRLDLSSTKKEQGLSDQEYKGANISKNKSIDIKDFQIETDQIDENK
LVKQKSNSSKIRNQNSSESKKSIQKSNSDSSDPQIIIQYNSDEEDGDESEEDNAHDDDDD
NEEEEYKNNSANNHFSQKNLNGNAPQKQQQQQAERRFSDNKQSVDQFSQNGINKKPNQSP
FQHSNTNQSQKTSPMNQNRSINGNQYQGESINQNQENKKQIKDYNIKDNEEDFEEYNIQA
SSKVENQIQNVNDQNPSLNLNSGTILEGVNGFNQKDHSNNTTKSTQGYKINSIHLNNHEQ
YLKQTIPISSNNQQVNKQRSQSNQGNINPLYSNTENKSHRAKTIFDRKVVNGETQNTQNT
PQNNRLSVLEEKFSTEQSERLNEQQFTSYNTNWNQSISPEKQNRLSNQMNIKETNNSFYK
EKEAEQLESDANHIYNINQPKDKESLIQFEDASKENSFNSKGKRKLSFNEHEDHVIQRNA
LNKESFEIHYSNHKQNQLFLDSSHQLKEIEESQLKRIISDTNHQKKNLLVKDEMGNSNNN
NLDIGNQDLGKHMGKEIVIIPSSITNNNIQGGQKQIQSERVNTKSSSQSKLQTTALNKLE
LEKKKERKIQKFCQKFFKDLLKNRSGVPTLTQNNRKMNLDSETPNPDYNQQRSAKEGLLN
EDLRKELFNIEEHQKYRLVMDQFLKKFNKNPKEAIQFLIEKQLCDDSDEDIAYMLLTTEG
LNKEQLGQFFGSNKERNQKILEAFCGLMDFRNLRFDEAMRLFLSRFRLPGESQQIDRIVQ
KFTKVYSNDNPTVFKDEDTPYILCYSAIMLNVDAHSEKIEKNRKMQKATFVSNNLQCTRN
AVSKEFLEQLYDNIVKEKFETKVDYIEKIYSRVPIDSMKTQFDGQNRIRILKELQNGYNF
LKYGRYGKPHMRKVFINEARDKIVWNEVSEQPQMNNLMDKNANQKQPVEKKFKQRYILIK
DITDLTLGSNATEVMKKNNVPPEFDQFCFSIITSKRTLDLKSNDMDTKFKWIAFLYNDLN
DKRQQRKNKASITPEQKQINQERINEIWRLDIFSKWEDHWDYTSSKPKNISKYEKKFQKS
NFFSSICSCLSKRNQNGNIKSLNEENNSNNSQVPFGSKKDYEELDLAHQNNKSLLLISLW
KIGMPKWVRKTIWPLSIGNRLEITENLYKILLKQVQVSENNIGIANNQIMISIEKMKADL
SNRSGKRFFSQFNAPQLKMLENVLSAFIFYRPDVGYINEAMPNLAAVLISQLDEEYAVFK
AFINLLHSYHFLTFFRGEMSEIKWRVQFFNEYLQKRMHLVLQHFKALDLSSELFVMHWFL
NLFSNVFDQETVLRIWDNFLLEGEVFAYKAGIAFIEYFHLEFKMATFDDAINFLKNPPDD
IFCSDLYFDIIEDIKIPVKDFNDRLDQQNVAKLAPYILQQLL


>TTHERM_00402039(coding)
ATGAATAATCCTGAATAATATGGATCTGTTAAGAAGAAGCTAGCAAATATTTCTTCTTTT
TAAGCAGGGCCATAAGCGCTTGTGCAAGATCCTTAAATTTAATAAGCTAAATCTGACCAT
GCTGCACCATCTGCATATTCAACTTCGCAATTTTCTACCACTTCAATGCGTGATGGTAGC
AATATGATATATTAAAATGGCAATATCTAATAATCTAACCAATATAGACTAGATTTAAGC
AGCACAAAAAAGGAGCAAGGTTTAAGTGATTAGGAATATAAAGGAGCAAACATCAGTAAA
AATAAATCTATTGATATAAAGGACTTTTAAATTGAGACAGATTAAATAGATGAAAATAAG
CTAGTTAAATAAAAATCAAATAGCTCTAAAATTAGAAATTAAAATAGCTCAGAATCTAAA
AAATCGATATAAAAATCAAATTCGGATTCAAGTGATCCACAAATTATTATTTAATATAAT
TCAGACGAAGAAGATGGAGATGAAAGTGAAGAAGATAATGCTCATGATGACGATGATGAT
AATGAAGAAGAAGAATATAAAAATAATTCTGCTAATAATCATTTTTCATAGAAGAATTTA
AATGGAAATGCACCTTAAAAGTAGTAGTAGTAATAAGCAGAAAGAAGATTTAGTGATAAC
AAGTAATCAGTAGATTAATTTTCTTAGAATGGAATAAATAAAAAACCAAATTAGTCTCCC
TTTTAGCATTCAAATACCAATTAATCATAGAAAACTTCTCCAATGAATTAAAATAGGAGC
ATTAATGGAAACTAATATTAAGGTGAAAGCATCAATTAGAATTAAGAAAATAAGAAACAA
ATTAAAGATTATAACATTAAGGATAATGAAGAAGACTTTGAGGAATATAATATTTAAGCA
AGCTCTAAAGTAGAAAATTAGATATAAAATGTGAATGATTAAAATCCTTCTCTTAATTTA
AATTCAGGTACTATTCTTGAGGGAGTTAATGGATTCAATTAAAAAGATCATTCAAACAAC
ACTACAAAGAGCACATAAGGATATAAAATAAACTCTATACATCTCAACAACCACGAATAA
TATTTAAAATAGACCATACCAATTTCATCAAACAATCAATAAGTGAACAAATAAAGATCG
CAATCAAATTAAGGCAACATCAATCCTTTATATTCTAACACTGAAAATAAAAGTCATAGA
GCAAAAACCATATTTGATAGAAAAGTAGTTAATGGAGAAACTTAAAATACACAAAACACT
CCTTAAAATAATAGACTTTCAGTTTTAGAAGAGAAATTTTCAACAGAATAAAGTGAAAGA
TTAAATGAATAGCAATTTACTAGTTATAATACTAATTGGAATCAAAGTATTTCACCAGAA
AAACAGAATCGCTTATCCAACCAAATGAATATCAAAGAAACAAACAACAGCTTTTACAAA
GAGAAAGAAGCTGAATAACTAGAGAGCGATGCCAATCATATTTATAATATAAATTAACCA
AAAGATAAAGAAAGCTTAATTTAATTTGAAGATGCTTCGAAAGAAAACAGTTTCAACTCA
AAAGGTAAACGAAAACTATCATTTAATGAACATGAAGATCATGTTATTTAAAGAAATGCT
TTAAATAAAGAATCTTTTGAAATTCATTACAGCAATCATAAGTAAAATTAACTGTTTTTA
GACTCGTCTCACTAGCTCAAAGAAATAGAAGAAAGCTAGTTAAAAAGAATAATTTCTGAT
ACAAATCATCAGAAGAAAAATTTATTAGTAAAAGATGAAATGGGTAACTCAAACAATAAC
AACTTAGATATTGGAAATTAAGATTTAGGAAAACATATGGGAAAGGAAATAGTTATTATT
CCCAGCAGCATTACAAATAATAATATTTAAGGTGGTTAAAAATAAATTTAGTCTGAAAGA
GTAAACACAAAATCTTCAAGCTAAAGTAAACTCTAAACAACTGCTCTTAACAAACTTGAG
CTTGAGAAAAAGAAAGAACGTAAAATATAAAAGTTCTGTCAAAAATTTTTTAAAGATTTG
CTTAAAAATCGTTCTGGTGTTCCAACTCTCACCTAGAATAATAGAAAAATGAACTTAGAT
TCTGAGACTCCAAATCCAGACTATAACCAACAAAGATCAGCCAAAGAAGGTTTGCTTAAT
GAGGATCTTAGAAAAGAATTATTTAACATTGAAGAGCATCAAAAGTACAGACTCGTTATG
GATCAATTTTTAAAGAAATTTAATAAGAATCCTAAGGAAGCTATTTAGTTTTTAATTGAA
AAATAATTATGTGATGATTCTGATGAAGATATCGCTTACATGCTTTTAACTACTGAAGGT
TTAAATAAGGAGTAATTAGGTCAATTTTTTGGAAGTAATAAAGAAAGGAACTAGAAAATT
TTAGAAGCTTTTTGTGGACTGATGGATTTTAGAAACTTGAGGTTTGATGAAGCCATGAGA
CTATTTTTATCTCGTTTTAGATTACCAGGAGAGTCTTAATAAATAGATAGAATTGTTTAG
AAGTTTACAAAAGTATATAGTAATGATAATCCAACAGTTTTTAAAGATGAAGATACTCCT
TATATTCTTTGCTACTCTGCTATCATGTTGAACGTCGATGCTCACAGTGAAAAAATAGAG
AAGAATAGAAAGATGTAAAAGGCTACATTCGTTTCTAATAATCTTCAATGTACAAGAAAT
GCAGTTTCAAAGGAATTTTTAGAGCAACTCTATGATAATATTGTTAAAGAAAAATTCGAA
ACAAAAGTAGATTATATCGAAAAAATTTATTCAAGAGTGCCCATAGACTCTATGAAAACA
TAGTTTGATGGTTAAAATCGTATTCGTATTTTAAAGGAGCTTCAGAATGGGTATAATTTT
CTTAAATATGGGCGATACGGTAAGCCTCATATGAGAAAAGTTTTCATAAACGAAGCTAGA
GATAAGATAGTTTGGAATGAAGTAAGTGAATAACCATAAATGAATAATCTTATGGATAAA
AATGCGAATCAAAAGCAGCCAGTTGAGAAAAAATTTAAATAGCGCTATATTCTTATAAAG
GATATTACTGATCTTACATTAGGTAGTAACGCTACTGAAGTAATGAAAAAGAACAACGTT
CCTCCTGAATTTGATTAATTCTGCTTCTCTATAATAACTTCAAAGCGAACTCTGGACTTA
AAGAGCAACGACATGGATACTAAATTTAAATGGATTGCTTTTCTATATAACGATTTGAAT
GATAAAAGATAACAAAGAAAAAATAAAGCTAGCATAACTCCTGAATAAAAGTAAATAAAT
TAAGAGCGTATTAATGAAATATGGAGACTCGATATCTTCTCTAAATGGGAAGATCATTGG
GATTATACTTCTTCTAAACCTAAAAATATTTCAAAGTATGAAAAAAAATTTTAGAAATCT
AATTTTTTCTCTTCAATTTGCTCGTGTTTAAGTAAAAGAAATCAAAATGGAAATATTAAA
TCTTTAAATGAAGAAAATAATTCAAATAATAGCTAAGTTCCTTTTGGGTCTAAAAAAGAC
TACGAAGAACTTGACCTAGCCCACCAGAATAATAAATCTTTGCTTCTTATTTCACTTTGG
AAAATAGGAATGCCTAAATGGGTAAGAAAAACAATATGGCCTCTGAGTATTGGAAATCGT
CTAGAAATAACTGAAAATCTATACAAAATATTGCTTAAATAAGTATAAGTATCAGAAAAT
AACATAGGAATAGCAAACAATCAGATAATGATTTCTATCGAAAAAATGAAAGCTGATTTA
AGTAATAGAAGTGGGAAAAGATTCTTTTCCTAATTTAATGCACCTTAGCTAAAAATGCTA
GAGAATGTTTTAAGTGCATTTATCTTTTACAGACCAGACGTAGGCTATATTAATGAAGCT
ATGCCAAATCTTGCAGCAGTACTGATATCTCAATTAGATGAAGAATATGCTGTTTTTAAA
GCTTTCATAAATTTATTACATTCCTACCACTTTTTGACTTTTTTTAGAGGTGAAATGAGC
GAAATTAAATGGAGAGTTTAGTTTTTTAATGAATATCTTCAAAAGAGAATGCATCTTGTT
TTACAACACTTTAAGGCTCTGGATTTAAGTTCAGAATTGTTTGTTATGCACTGGTTCTTA
AATTTATTTTCAAATGTATTTGATTAAGAAACTGTACTTAGGATTTGGGATAACTTCTTA
CTCGAAGGAGAAGTTTTTGCCTATAAAGCTGGAATAGCATTTATAGAATATTTCCATTTA
GAATTTAAAATGGCGACTTTTGATGATGCTATAAATTTCCTTAAAAATCCACCAGATGAC
ATATTCTGCTCTGATTTATATTTTGACATTATTGAAGACATAAAAATACCAGTAAAAGAT
TTCAATGACCGTTTAGATTAGTAGAATGTTGCTAAATTAGCTCCTTACATCCTACAACAG
CTCTTATGA


>TTHERM_00402039(gene)
ATGAATAATCCTGAATAATATGGATCTGTTAAGAAGAAGCTAGCAAATATTTCTTCTTTT
TAAGCAGGGCCATAAGCGCTTGTGCAAGATCCTTAAATTTAATAAGCTAAATCTGACCAT
GCTGCACCATCTGCATATTCAACTTCGCAATTTTCTACCACTTCAATGCGTGATGGTAGC
AATATGATATATTAAAATGGCAATATCTAATAATCTAACCAATATAGACTAGATTTAAGC
AGCACAAAAAAGGAGCAAGGTTTAAGTGATTAGGAATATAAAGGAGCAAACATCAGTAAA
AATAAATCTATTGATATAAAGGACTTTTAAATTGAGACAGATTAAATAGATGAAAATAAG
CTAGTTAAATAAAAATCAAATAGCTCTAAAATTAGAAATTAAAATAGCTCAGAATCTAAA
AAATCGATATAAAAATCAAATTCGGATTCAAGTGATCCACAAATTATTATTTAATATAAT
TCAGACGAAGAAGATGGAGATGAAAGTGAAGAAGATAATGCTCATGATGACGATGATGAT
AATGAAGAAGAAGAATATAAAAATAATTCTGCTAATAATCATTTTTCATAGAAGAATTTA
AATGGAAATGCACCTTAAAAGTAGTAGTAGTAATAAGCAGAAAGAAGATTTAGTGATAAC
AAGTAATCAGTAGATTAATTTTCTTAGAATGGAATAAATAAAAAACCAAATTAGTCTCCC
TTTTAGCATTCAAATACCAATTAATCATAGAAAACTTCTCCAATGAATTAAAATAGGAGC
ATTAATGGAAACTAATATTAAGGTGAAAGCATCAATTAGAATTAAGAAAATAAGAAACAA
ATTAAAGATTATAACATTAAGGATAATGAAGAAGACTTTGAGGAATATAATATTTAAGCA
AGCTCTAAAGTAGAAAATTAGATATAAAATGTGAATGATTAAAATCCTTCTCTTAATTTA
AATTCAGGTACTATTCTTGAGGGAGTTAATGGATTCAATTAAAAAGATCATTCAAACAAC
ACTACAAAGAGCACATAAGGATATAAAATAAACTCTATACATCTCAACAACCACGAATAA
TATTTAAAATAGACCATACCAATTTCATCAAACAATCAATAAGTGAACAAATAAAGATCG
CAATCAAATTAAGGCAACATCAATCCTTTATATTCTAACACTGAAAATAAAAGTCATAGA
GCAAAAACCATATTTGATAGAAAAGTAGTTAATGGAGAAACTTAAAATACACAAAACACT
CCTTAAAATAATAGACTTTCAGTTTTAGAAGAGAAATTTTCAACAGAATAAAGTGAAAGA
TTAAATGAATAGCAATTTACTAGTTATAATACTAATTGGAATCAAAGTATTTCACCAGAA
AAACAGAATCGCTTATCCAACCAAATGAATATCAAAGAAACAAACAGTAACAAATATTAT
TTTTATTTAATTAGCTTAAAATACTTCATAAGCCTCATTAATTCATTACTAAGGCTACTG
TTTTAAACAAAAATTGAATTAAAAATTTTAAATATTTTATTATTTATTTTTAAATTAGAT
TTTTTAATTCAATTTTATCAAAATTTTGAGCTATTATTTTAGATATATTTTTATTAGAAT
AGAAAGAAAAATAAATCTAAATTTTAATTAAAATAACTAAAATTTTACTAAAAAAGCTTT
GAAAATAACCCTTCAGATGCAATAATTTTTGAAATTTTTTCTTAGAAATCTACAAAAAAT
GAAAGCAAAATTAGACATTTATTTTATTTTTATAATAAAAATTGGAAGTTTGTTTGTTAG
AAAGCAAAATAATTGATTTAAACTTTTAATCATGAACTATTTTATAATATAAAAATAGAC
AGCTTTTACAAAGAGAAAGAAGCTGAATAACTAGAGAGCGATGCCAATCATATTTATAAT
ATAAATTAACCAAAAGATAAAGAAAGCTTAATTTAATTTGAAGATGCTTCGAAAGAAAAC
AGTTTCAACTCAAAAGGTAAACGAAAACTATCATTTAATGAACATGAAGATCATGTTATT
TAAAGAAATGCTTTAAATAAAGAATCTTTTGAAATTCATTACAGCAATCATAAGTAAAAT
TAACTGTTTTTAGACTCGTCTCACTAGCTCAAAGAAATAGAAGAAAGCTAGTTAAAAAGA
ATAATTTCTGATACAAGTAAATCTTAAAATCTAATTATTTCAAAATAAAAATTATTTTTA
AACTTCATTTTAGATCATCAGAAGAAAAATTTATTAGTAAAAGATGAAATGGGTAACTCA
AACAATAACAACTTAGATATTGGAAATTAAGATTTAGGAAAACATATGGGAAAGGAAATA
GTTATTATTCCCAGCAGCATTACAAATAATAATATTTAAGGTGGTTAAAAATAAATTTAG
TCTGAAAGAGTAAACACAAAATCTTCAAGCTAAAGTAAACTCTAAACAACTGCTCTTAAC
AAACTTGAGCTTGAGAAAAAGAAAGAACGTAAAATATAAAAGTTCTGTCAAAAATTTTTT
AAAGATTTGCTTAAAAATCGTTCTGGTGTTCCAACTCTCACCTAGAATAATAGAAAAATG
AACTTAGATTCTGAGACTCCAAATCCAGACTATAACCAACAAAGATCAGCCAAAGAAGGT
TTGCTTAATGAGGGTAATAATTATTTTTTTTTAAATGGTTTAACTTTAAATAAAATATTG
ATAATTATTATAAAGATCTTAGAAAAGAATTATTTAACATTGAAGAGCATCAAAAGTACA
GACTCGTTATGGATCAATTTTTAAAGAAATTTAATAAGAATCCTAAGGAAGCTATTTAGT
TTTTAATTGAAAAATAATTATGTGATGATTCTGATGAAGATATCGCTTACATGCTTTTAA
CTACTGAAGGTTTAAATAAGGAGTAATTAGGTCAATTTTTTGGAAGTAATAAAGAAAGGA
ACTAGAAAATTTTAGAAGCTTTTTGTGGACTGATGGATTTTAGAAACTTGAGGTTTGATG
AAGCCATGAGACTATTTTTATCTCGTTTTAGATTACCAGGAGAGTCTTAATAAATAGATA
GAATTGTTTAGAAGTTTACAAAAGTATATAGTAATGATAATCCAACAGTTTTTAAAGATG
AAGATACTCCTTATATTCTTTGCTACTCTGCTATCATGTTGAACGTCGATGCTCACAGTG
AAAAAATAGAGAAGAATAGAAAGATGTAAAAGGCTACATTCGTTTCTAATAATCTTCAAT
GTACAAGAAATGCAGTTTCAAAGGAATTTTTAGAGCAACTCTATGATAATATTGTTAAAG
AAAAATTCGAAACAAAAGTAGATTATATCGAAAAAATTTATTCAAGAGTGCCCATAGACT
CTATGAAAACATAGTTTGATGGTTAAAATCGTATTCGTATTTTAAAGGAGCTTCAGAATG
GGTATAATTTTCTTAAATATGGGCGATACGGTAAGCCTCATATGAGAAAAGTTTTCATAA
ACGAAGCTAGAGATAAGATAGTTTGGAATGAAGTAAGTGAATAACCATAAATGAATAATC
TTATGGATAAAAATGCGAATCAAAAGCAGCCAGTTGAGAAAAAATTTAAATAGCGCTATA
TTCTTATAAAGGATATTACTGATCTTACATTAGGTAGTAACGCTACTGAAGTAATGAAAA
AGAACAACGTTCCTCCTGAATTTGATTAATTCTGCTTCTCTATAATAACTTCAAAGCGAA
CTCTGGACTTAAAGAGCAACGACATGGATACTAAATTTAAATGGATTGCTTTTCTATATA
ACGATTTGAATGATAAAAGATAACAAAGAAAAAATAAAGCTAGCATAACTCCTGAATAAA
AGTAAATAAATTAAGAGCGTATTAATGAAATATGGAGACTCGATATCTTCTCTAAATGGG
AAGATCATTGGGATTATACTTCTTCTAAACCTAAAAATATTTCAAAGTATGAAAAAAAAT
TTTAGAAATCTAATTTTTTCTCTTCAATTTGCTCGTGTTTAAGTAAAAGAAATCAAAATG
GAAATATTAAATCTTTAAATGAAGAAAATAATTCAAATAATAGCTAAGTTCCTTTTGGGT
CTAAAAAAGACTACGAAGAACTTGACCTAGCCCACCAGAATAATAAATCTTTGCTTCTTA
TTTCACTTTGGAAAATAGGAATGCCTAAATGGGTAAGAAAAACAATATGGCCTCTGAGTA
TTGGAAATCGTCTAGAAATAACTGAAAATCTATACAAAATATTGCTTAAATAAGTATAAG
TATCAGAAAATAACATAGGAATAGCAAACAATCAGATAAGTAATATTTTTTTTACTTTAA
AATATATATTTTTTAAATCTTTCTATATCCCAATTTATTAATTTTTACTTCAACAGAAAA
TAAAATAAACATTTGATATCAAAAGTGTTTATATATCTTAGTAGTTTGATGAGCATTATA
AAATATTTATATTTTTTAATAGAACTCTGATAATTAATTAAAATTATTTAAACCAGATTA
ATTTTATTTTAGAAGATCTTCCCTTAATTTATCTAATTAATAAATTATTTTTATTATTTG
TTGATGGTTTTTTAGTTAACCAACAAATTAGTCAATCTCAATTTATTTCAATAATAATAT
TTTTAATTAATTAATAGTGATTTCTATCGAAAAAATGAAAGCTGATTTAAGTAATAGAAG
TGGGAAAAGATTCTTTTCCTAATTTAATGCACCTTAGCTAAAAATGCTAGAGAATGTTTT
AAGTGCATTTATCTTTTACAGACCAGACGTAGGCTATATTAATGAAGCTATGCCAAATCT
TGCAGCAGTACTGATATCTCAATTAGATGAAGAATATGCTGTTTTTAAAGCTTTCATAAA
TTTATTACATTCCTACCACTTTTTGACTTTTTTTAGAGGTGAAATGAGCGAAATTAAATG
GAGAGTTTAGTTTTTTAATGAATATCTTCAAAAGAGAATGCATCTTGTTTTACAACACTT
TAAGGCTCTGGATTTAAGTTCAGAATTGTTTGTTATGCACTGGTTCTTAAATTTATTTTC
AAATGTATTTGATTAAGAAACTGTACTTAGGATTTGGGATAACTTCTTACTCGAAGGAGA
AGTTTTTGCCTATAAAGCTGGAATAGCATTTATAGAATATTTCCATTTAGAATTTAAAAT
GGCGACTTTTGATGATGCTATAAATTTCCTTAAAAATCCACCAGATGACATATTCTGCTC
TGATTTATATTTTGACATTATTGAAGACATAAAAATACCAGTAAAAGATTTCAATGACCG
TTTAGATTAGTAGAATGTTGCTAAATTAGCTCCTTACATCCTACAACAGCTCTTATGA