Identifiers and Description

Gene Model Identifier

TTHERM_00082170

Standard Name

TBP2 (TATA-box-binding protein 2)

Aliases

PreTt16263 | 6.m00337 | 3836.m01935

Description

TATA-box-binding protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

  • regulation of transcription, DNA-templated (IEA) | GO:0006355
  • transcription initiation from RNA polymerase II promoter (IEA) | GO:0006367

Domains

  • ( PF00352 ) Transcription factor TFIID (or TATA-binding

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00082170

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02361.12.9990837046884738e-127TATA-box binding protein (231
aa)
DictyBaseDDB_G02756172.999884853455273e-42tbpA on chromosome: 2 position
6092208 to 6093026
OxytrichaContig262.1.g327.000550667562452e-41Transcription factor TFIID (or
TATA-binding protein, TBP)
SGDYER148W1.000403801267624e-40SPT15 TATA-binding protein, ge
neral transcription factor tha
t interacts with other factors
to form the preinitiation com
plex at promoters, essential f
or viability
WormBaseWBGene000065429.9981864321491e-40locus:tbp-1 TATA-box-binding
protein status:Confirmed
UniProt:P32085 protein_id:CC
D69071.1
Stentor CoeruleusSteCoe_110681.4251640827409352e-21

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00082170(coding)
ATGAATTCAGCTAATTAGCAAAATAAATCTGACGACACTCCAAAAATCCAAAACGTAGTC
GCAACCATCAAGATGATTCGTCAAGATGGCAACAGCAGCAAGCAAAAATAGACTTTTGAT
CTTTAGGAGATTGCGCAAAAGTGTCGTAATACTTAGTACAATCCAAAAAGATTTCCTGCT
GTATTCATGCGTATTAAAGATCCCAAAGCAACTGGTTTAATTTATTCTTCTGGAAATATG
ACAATCGTTGGAACAAGAAGTACAAATGAAAGTCAAACTGCCGCAGAGAGAATTTTCGGT
ATCATCAAAAAACAGCTCAATGTGGACTGTAGATTTGAGAATAAAGAAGTCCAAGTTAGA
AATATAGTCGCCTCATGTAAACTAGGATACCCTGTGTGTCTAGATAAAATACATGATGAT
AAAGATCATAAGCAATTCTCAACTTATGATGATACATTCCCCGGTTTAATTTATCGCTAT
ATGCTTAATCCTGGTGAGTAAAAGAAAAAAAATAACATTATTGCGTTAGTTTTCGCATCT
GGTAAAATGGTTTTCACAGGTGCAAAAAGCTAAGAAGATATTTAGTAAGCATACGATAAA
ATCAAACCAGAATTTGTTGCCTTTATGAAGAAAGAACCACCATCCAGCAACGCCCAAAAT
GGTGGTTAATTAGGACAAAATATGGTGCAAAATTGA


>TTHERM_00082170(protein)
MNSANQQNKSDDTPKIQNVVATIKMIRQDGNSSKQKQTFDLQEIAQKCRNTQYNPKRFPA
VFMRIKDPKATGLIYSSGNMTIVGTRSTNESQTAAERIFGIIKKQLNVDCRFENKEVQVR
NIVASCKLGYPVCLDKIHDDKDHKQFSTYDDTFPGLIYRYMLNPGEQKKKNNIIALVFAS
GKMVFTGAKSQEDIQQAYDKIKPEFVAFMKKEPPSSNAQNGGQLGQNMVQN


>TTHERM_00082170(gene)
ATGAATTCAGCTAATTAGCAAAATAAATCTGACGACACTCCAAAAATCCAAAACGTAGTC
GCAACCATCAAGATGATTCGTCAAGATGGCAACAGCAGCAAGCAAAAATAGACTTTTGAT
CTTTAGGAGATTGCGCAAAAGTGTCGTAATACTTAGTACAATCCAAAAAGATTTCCTGCT
GTATTCATGCGTATTAAAGATCCCAAAGCAACTGGTTTAATTTATTCTTCTGGAAATATG
ACAATCGTTGGAACAAGAAGTACAAATGAAAGTCAAACTGCCGCAGAGAGAATTTTCGGT
ATCATCAAAAAACAGCTCAATGTGGACTGTAGATTTGAGAATAAAGAAGTCCAAGTTAGA
AATATAGTCGCCTCATGTAAACTAGGATACCCTGTGTGTCTAGATAAAATACATGATGAT
AAAGATCATAAGCAATTCTCAACTTATGATGATACATTCCCCGGTTTAATTTATCGCTAT
ATGCTTAATCCTGGTGAGTAAAAGAAAAAAAATAACATTATTGCGTTAGTTTTCGCATCT
GGTAAAATGGTTTTCACAGGTGCAAAAAGCTAAGAAGATATTTAGTAAGCATACGATAAA
ATCAAACCAGAATTTGTTGCCTTTATGAAGAAAGAACCACCATCCAGCAACGCCCAAAAT
GGTGGTTAATTAGGACAAAATATGGTGCAAAATTGA