Identifiers and Description

Gene Model Identifier

TTHERM_00575350

Standard Name

TBP1 (TATA-Binding Protein )

Aliases

PreTt28925 | 77.m00137 | TATA-binding protein | 3812.m02620

Description

TATA-binding protein; component of the basal transcription apparatus; found in macronuclei throughout life cycle, but only found in micronuclei early in conjugation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00575350

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04002.18.000194140818961e-170TATA-box binding protein (246
aa)
SGDYER148W5.0002513615276457e-88SPT15 TATA-binding protein, ge
neral transcription factor tha
t interacts with other factors
to form the preinitiation com
plex at promoters, essential f
or viability
DictyBaseDDB_G02756175.998372506255629e-88tbpA on chromosome: 2 position
6092208 to 6093026
WormBaseWBGene000065422.0000012618802033e-84locus:tbp-1 TATA-box-binding
protein status:Confirmed
UniProt:P32085 protein_id:CC
D69071.1
OxytrichaContig262.1.g326.999281070199524e-80Transcription factor TFIID (or
TATA-binding protein, TBP)
Stentor CoeruleusSteCoe_110688.985825944049381e-37

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:9115421: Tsukiyama T, Wu C (1997) Chromatin remodeling and transcription. Current opinion in genetics & development 7(2):182-91
  2. Ref:8756729: Shen X, Gorovsky MA (1996) Linker histone H1 regulates specific gene expression but not global transcription in vivo. Cell 86(3):475-83
  3. Ref:7579709: Lu MJ, Mpoke SS, Dadd CA, Allis CD (1995) Phosphorylated and dephosphorylated linker histone H1 reside in distinct chromatin domains in Tetrahymena macronuclei. Molecular biology of the cell 6(8):1077-87
  4. Ref:8264641: Stargell LA, Gorovsky MA (1994) TATA-binding protein and nuclear differentiation in Tetrahymena thermophila. Molecular and cellular biology 14(1):723-34
  5. Ref:8177745: Liu X, Gorovsky MA (1993) Mapping the 5' and 3' ends of Tetrahymena thermophila mRNAs using RNA ligase mediated amplification of cDNA ends (RLM-RACE). Nucleic acids research 21(21):4954-60

Sequences

>TTHERM_00575350(coding)
ATGAGCAGCGATAAAACATCTCAGCAGACTTTTAAGTTAGCACCAAACAATAGCGTCGCT
TAGAGCAATAGCATAGACCAAAATAAAAATAAAAACAATATCCTTAGCACTATAGAAACG
ATGGATAAGAGCATAAGTGAAGATTTATACCCAAAATTGTAGAATATTGTTTCCACTGTA
AATCTTAGTACAAAATTAGATTTAAAGCAAATAGCTCTTAGAGCCAGAAATGCTGAATAC
AATCCTAAAAGATTTGCTGCAGTAATTATGAGATTGAGAGATCCTAAAACTACAGCTCTG
ATTTTTGCTTCTGGTAAAATGGTGTGTACGGGTGCAAAAACAGAAGAAGATTCTAATAGA
GCTGCAAGAAAGTATGCTAAGATTATCTAAAAAATAGGTTTCCCCGTACAGTTCAAAGAT
TTTAAAATATAAAATATAGTAGGATCGACTGATGTAAAATTCCCCATCAATCTTGACCAT
CTTGAATAAGACCATAAAAAGTTCGTTTAGTATGAACCTGAAATTTTCCCTGGCTTGATT
TATCGTGAATTTAATACAAAAATAGTTCTCTTAATCTTCGTATCAGGTAAAATTGTACTG
ACAGGTGCAAAAACTAGAGAAAATATTAACAAAGCTTTCTAAAAAATATATTGGGTTTTG
TACAATTACTAGAAAAAAGACTATAGAGGTGCAAATCTTCATAATTAAAATTTAAATATT
AAACCTAGTATAAAAAATTGA


>TTHERM_00575350(protein)
MSSDKTSQQTFKLAPNNSVAQSNSIDQNKNKNNILSTIETMDKSISEDLYPKLQNIVSTV
NLSTKLDLKQIALRARNAEYNPKRFAAVIMRLRDPKTTALIFASGKMVCTGAKTEEDSNR
AARKYAKIIQKIGFPVQFKDFKIQNIVGSTDVKFPINLDHLEQDHKKFVQYEPEIFPGLI
YREFNTKIVLLIFVSGKIVLTGAKTRENINKAFQKIYWVLYNYQKKDYRGANLHNQNLNI
KPSIKN


>TTHERM_00575350(gene)
ATGAGCAGCGATAAAACATCTCAGCAGACTTTTAAGTTAGCACCAAACAATAGCGTCGCT
TAGAGCAATAGCATAGACCAAAATAAAAATAAAAACAATATCCTTAGCACTATAGAAACG
ATGGATAAGAGCATAAGTGAAGATTTATACCCAAAATTGTAGAATATTGTTTCCACTGTA
AATCTTAGTACAAAATTAGATTTAAAGCAAATAGCTCTTAGAGCCAGAAATGCTGAATAC
AATCCTAAAAGATTTGCTGCAGTAATTATGAGATTGAGAGATCCTAAAACTACAGCTCTG
ATTTTTGCTTCTGGTAAAATGGTGTGTACGGGTGCAAAAACAGAAGAAGATTCTAATAGA
GCTGCAAGAAAGTATGCTAAGATTATCTAAAAAATAGGTTTCCCCGTACAGTTCAAAGAT
TTTAAAATATAAAATATAGTAGGATCGACTGATGTAAAATTCCCCATCAATCTTGACCAT
CTTGAATAAGACCATAAAAAGTTCGTTTAGTATGAACCTGAAATTTTCCCTGGCTTGATT
TATCGTGAATTTAATACAAAAATAGTTCTCTTAATCTTCGTATCAGGTAAAATTGTACTG
ACAGGTGCAAAAACTAGAGAAAATATTAACAAAGCTTTCTAAAAAATATATTGGGTTTTG
TACAATTACTAGAAAAAAGACTATAGAGGTGCAAATCTTCATAATTAAAATTTAAATATT
AAACCTAGTATAAAAAATTGA