Identifiers and Description

Gene Model Identifier

TTHERM_00933110

Standard Name

TASS1 (Telomere ASSociated)

Aliases

PreTt17910 | 168.m00078 | 3745.m00023

Description

Protein localizes to MIC telomeres in meiosis, Co-IPs with Teb1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00933110

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00933110(coding)
ATGAACTAAACTATCCATAATATCTATAATAATATGTAAAATAATATAAATGACATAGAA
TTTTAGAAGTAAAAATAAGAATAAAGCAGGTTTCTAACTTAAAAATAAACAGATCCTAAT
ATAACTCAAGCTACTGATTGCAAATTAGAAAATATATACCAAAAATAAGATATTATGAAT
TAAGTTTGTAATGATCAACTTTAACAAGACTAATTGAATAACAATAAATAAAATCAAATA
AATTCATAGATTATCTAAAAGGATAAATAAGGTAGGTAAAATAATCAGATTTAATCATTT
CTTTAAAATTTTGAAGATAGCCTCAATGGTGACTATTCAAAAATGGTTTAAAATATACAA
AGTTAAAAATCATTCGATAATGATAAAATTAGCGATAACATCAGTGGATCAGATTTTGAA
AAAAAGTGTCAAATAAGAAATGATTTAAAATAAGTAAGTAAATAAATGAACGAGAGTTTA
ATAAATTAGAAACTTACAAGCTCATAGTTTTTAAGCTAGGATAAATCTTTTTTGTTTAAA
AAAACAAGTGTTAGTTAAAAAGAAATAGATGTTAGCAAAAATAATTAAATTTTAGGGAAT
AATATTATGAATTCTAATCCTTATTAAGTTGTTAATGTAGGTTTATCTAAAGTAGCTTTA
AAAAATAAATTAAACCCTTCTATGCTTAAAAAATTTTAGAATGTTGGAGAACAACAAGAA
GACTATTTGGTATAACTTTTTGATGATGAGAGTCCAAAAAATGATCAAAGATAAGTTTTT
AATTTTTCTGATAAAAATATTGATGTAAATGTTTAAGATTAAATTTAAAATGAAGAGATT
AAATAATTCATCTTAAATGGACATATTACGTAGACTTATTAATAAAGCGAATAGTAAAAA
TAAACTAGAAAAAAGCTGGAAAGCTAAATAATTAATATATTGTAAAATCTAAAAACATCT
AATAATTAAAAATTGATTACATTATTATCTTGTATTGATGATGATAATGATTAAGATTAT
GATAATAATTTAGATTATAAGATGTAAATAAGATAAAAATATTTATAACAGTGA


>TTHERM_00933110(protein)
MNQTIHNIYNNMQNNINDIEFQKQKQEQSRFLTQKQTDPNITQATDCKLENIYQKQDIMN
QVCNDQLQQDQLNNNKQNQINSQIIQKDKQGRQNNQIQSFLQNFEDSLNGDYSKMVQNIQ
SQKSFDNDKISDNISGSDFEKKCQIRNDLKQVSKQMNESLINQKLTSSQFLSQDKSFLFK
KTSVSQKEIDVSKNNQILGNNIMNSNPYQVVNVGLSKVALKNKLNPSMLKKFQNVGEQQE
DYLVQLFDDESPKNDQRQVFNFSDKNIDVNVQDQIQNEEIKQFILNGHITQTYQQSEQQK
QTRKKLESQIINILQNLKTSNNQKLITLLSCIDDDNDQDYDNNLDYKMQIRQKYLQQ


>TTHERM_00933110(gene)
ATGAACTAAACTATCCATAATATCTATAATAATATGTAAAATAATATAAATGACATAGAA
TTTTAGAAGTAAAAATAAGAATAAAGCAGGTTTCTAACTTAAAAATAAACAGATCCTAAT
ATAACTCAAGCTACTGATTGCAAATTAGAAAATATATACCAAAAATAAGATATTATGAAT
TAAGTTTGTAATGATCAACTTTAACAAGACTAATTGAATAACAATAAATAAAATCAAATA
AATTCATAGATTATCTAAAAGGATAAATAAGGTAGGTAAAATAATCAGATTTAATCATTT
CTTTAAAATTTTGAAGATAGCCTCAATGGTGACTATTCAAAAATGGTTTAAAATATACAA
AGTTAAAAATCATTCGATAATGATAAAATTAGCGATAACATCAGTGGATCAGATTTTGAA
AAAAAGTGTCAAATAAGAAATGATTTAAAATAAGTAAGTAAATAAATGAACGAGAGTTTA
ATAAATTAGAAACTTACAAGCTCATAGTTTTTAAGCTAGGATAAATCTTTTTTGTTTAAA
AAAACAAGTGTTAGTTAAAAAGAAATAGATGTTAGCAAAAATAATTAAATTTTAGGGAAT
AATATTATGAATTCTAATCCTTATTAAGTTGTTAATGTAGGTTTATCTAAAGTAGCTTTA
AAAAATAAATTAAACCCTTCTATGCTTAAAAAATTTTAGAATGTTGGAGAACAACAAGGT
TACAAATATTTTATTTTTTTATCATTTTAAAAACATTAATTAACTATTATATTTATAGAA
GACTATTTGGTATAACTTTTTGATGATGAGAGTCCAAAAAATGATCAAAGATAAGTTTTT
AATTTTTCTGATAAAAATATTGATGTAAATGTTTAAGATTAAATTTAAAATGAAGAGATT
AAATAATTCATCTTAAATGGACATATTACGTAGACTTATTAATAAAGCGAATAGTAAAAA
TAAACTAGAAAAAAGCTGGAAAGCTAAATAATTAATATATTGTAAAATCTAAAAACATCT
AATAATTAAAAATTGATTACATTATTATCTTGTATTGATGATGATAATGATTAAGATTAT
GATAATAATTTAGATTATAAGATGTAAATAAGATAAAAATATTTATAACAGTGA