Identifiers and Description

Gene Model Identifier

TTHERM_00059040

Standard Name

TAP75 (Telomerase- (or TERT-) Associated Protein )

Aliases

PreTt13088 | 4.m00487 | p75 | 3707.m00132

Description

75 kD Telomerase- (or TERT-) associated protein; essential gene; telomerase holoenzyme subunit; required for telomere maintenance

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.6%

TetraMine Data

TTHERM_00059040

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02007.12.0004037638327014e-151hypothetical protein (444 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:17220281: Witkin KL, Prathapam R, Collins K (2007) Positive and negative regulation of Tetrahymena telomerase holoenzyme. Molecular and cellular biology 27(6):2074-83

Sequences

>TTHERM_00059040(coding)
ATGGAAATTGAAGAAGATTTGAATTTAAAAATACTTGAAGATGTCAAAAAATTATATTTA
TAGTCTTTTGACTATATAAAAAATGGAATAAGTAGCAGTTTACCTAGCGATAAAAAATTT
TTGGCAGATGATGATATTGATCTTAGCAGAATTACTTTTTTGTACAAGTTTATATCAGTG
AATCCTACCCTGCTATTAATAAATGAAAAAACTTAAGCAAAAAGGCGCATATTTTAAGGC
GAGTATTTATATGGTAAAAAGAAAATCTAATTTAATATTATTGCTAAGAACTTGGAAATA
GAAAGAGAATTAATATAATTTTTCAAAAAACCATATTAGTGCTACATAATGCATAATGTA
TAAGTTTTTTAGATGCTCAATAAAAATAAAAATAATAATGTTGTTGAATTTATGGATTCT
GAAGATCTTTAAAGCTCTGTAGATTGCTAATTATATTATCTTATTGATGAGTCTTCGCAT
GTATTAGAAGATGATTCTATGGATTTTATTTCTACTCTCACCAGGTTATCTGATAGCTTT
AATTCTAATGAATTCGTATTTGAAACAAACTACTCTATCTAAATTTCATAGATGCCGAAG
CCACTAAATACAACCCACTTTAAATTACTTTAACCAAAAGTTGTGAATTCTTTTGAGGGA
GTTATTTTGCAAGTTTAAGAAGGTAAAAACATTTTATAAATAGAAGAACTTATTGACTAA
GTTTATTTGAATTCCCGTAGAGATAGATTTTATATTCTTAAAGTAGCTAATGGAAAAAAC
TATATGGATTTTATAGAAGTTTATCTTGTATACGATAATGAAGACCAAGAAGCTAAATAA
TAATTATAATTTTATTTAAAACCATTTTAACGTATACTTATATTTTAATCTTTAAAACAC
TTCACTAAAAATTTGAAATTGTTTATGATTTCATTTTTTTATTCTTCTGGAGTTTAACCT
AACAACTCAAATGTGAAAAACTTTTTGGTTTCACATAAAGGAGTTGAATTTTTTAGTAGA
TTTGACATATAAAAGAACGAATTGCTCTGTAAAGATTTGATAAAAAGTTATAACAAATTA
CCACTTAGTAATATTTCTAAACTTTTAGAGGACGAAGGAGTAATGATTCGTTCTAATATG
AAATTTTAAGTAAGAGTAAAAAAAGTAAAATATTTTAAAATACGTTTAAATTGTCTAAAT
TGTAAATAAGAATGGACTGTGGGATTGAAAAATTGTATAAATTGTAAAGGGTAACAAAGT
TATATTAGCTACAACATATAAGTTCTTGTTTAAGACTAACATTTTTTAGAATAGCAAGCA
TACATTTATCTCTACGATGATTTAGCAGCACAGTTCTTTAACATAACTGAAAGCGAAAAG
AAAGAACTGCACCTACACCTTACTAAAAATGAAACTTTTATATAGCTTTATTACAGCTTT
AATAAAGATTACCCACTATCTATTATTAAATTTAAAGATAAAATATTTAACAAAGATATT
ACTAATTGTATTGTTGCATATCCATTTGCAGATATAGATAACAAAATTTTCAATTCCTAG
TAATAAATCATTTAAGATGAAAATCTTAGGATAGAAAGTGAAAAATTTATTTAAAACTTT
ACAGAAGATAATAATTTGTAGGAATCTAAATTGTATTACGAAAAATTTAAAAGCAAAAAT
AAGCAACAAATTTTTGTAAATGGAACCTATATTTCTACAAATTACTCATAAGGATAAAAA
ATATGTTTAAAGCCTATTCCTTGTTTAAAAGTAATGTATGTGTTTCCACAAGAAGATATA
AAACTATCAGCCCTTAAAATTATAGAAGAAATAAACTAATTAAAAATACAAATAGATTAG
TTAAATTGA


>TTHERM_00059040(protein)
MEIEEDLNLKILEDVKKLYLQSFDYIKNGISSSLPSDKKFLADDDIDLSRITFLYKFISV
NPTLLLINEKTQAKRRIFQGEYLYGKKKIQFNIIAKNLEIERELIQFFKKPYQCYIMHNV
QVFQMLNKNKNNNVVEFMDSEDLQSSVDCQLYYLIDESSHVLEDDSMDFISTLTRLSDSF
NSNEFVFETNYSIQISQMPKPLNTTHFKLLQPKVVNSFEGVILQVQEGKNILQIEELIDQ
VYLNSRRDRFYILKVANGKNYMDFIEVYLVYDNEDQEAKQQLQFYLKPFQRILIFQSLKH
FTKNLKLFMISFFYSSGVQPNNSNVKNFLVSHKGVEFFSRFDIQKNELLCKDLIKSYNKL
PLSNISKLLEDEGVMIRSNMKFQVRVKKVKYFKIRLNCLNCKQEWTVGLKNCINCKGQQS
YISYNIQVLVQDQHFLEQQAYIYLYDDLAAQFFNITESEKKELHLHLTKNETFIQLYYSF
NKDYPLSIIKFKDKIFNKDITNCIVAYPFADIDNKIFNSQQQIIQDENLRIESEKFIQNF
TEDNNLQESKLYYEKFKSKNKQQIFVNGTYISTNYSQGQKICLKPIPCLKVMYVFPQEDI
KLSALKIIEEINQLKIQIDQLN


>TTHERM_00059040(gene)
ATGGAAATTGAAGAAGATTTGAATTTAAAAATACTTGAAGATGTCAAAAAATTATATTTA
TAGTCTTTTGACTATATAAAAAATGGAATAAGTAGCAGTTTACCTAGCGATAAAAAATTT
TTGGCAGATGATGATATTGATCTTAGCAGAATTACTTTTTTGTACAAGTTTATATCAGTG
AATCCTACCCTGCTATTAATAAATGAAAAAACTTAAGCAAAAAGGCGCATATTTTAAGGC
GAGTATTTATATGGTAAAAAGAAAATCTAATTTAATATTATTGCTAAGAACTTGGAAATA
GAAAGAGAATTAATATAATTTTTCAAAAAACCATATTAGTGCTACATAATGCATAATGTA
TAAGTTTTTTAGATGCTCAATAAAAATAAAAATAATAATGTTGTTGAATTTATGGATTCT
GAAGATCTTTAAAGCTCTGTAGATTGCTAATTATATTATCTTATTGATGAGTCTTCGCAT
GTATTAGAAGATGATTCTATGGATTTTATTTCTACTCTCACCAGGTTATCTGATAGCTTT
AATTCTAATGAATTCGTATTTGAAACAAACTACTCTATCTAAATTTCATAGATGCCGAAG
CCACTAAATACAACCCACTTTAAATTACTTTAACCAAAAGTTGTGAATTCTTTTGAGGGA
GTTATTTTGCAAGTTTAAGAAGGTAAAAACATTTTATAAATAGAAGAACTTATTGACTAA
GTTTATTTGAATTCCCGTAGAGATAGATTTTATATTCTTAAAGTAGCTAATGGAAAAAAC
TATATGGATTTTATAGAAGTTTATCTTGTATACGATAATGAAGACCAAGAAGCTAAATAA
TAATTATAATTTTATTTAAAACCATTTTAACGTATACTTATATTTTAATCTTTAAAACAC
TTCACTAAAAATTTGAAATTGTTTATGATTTCATTTTTTTATTCTTCTGGAGTTTAACCT
AACAACTCAAATGTGAAAAACTTTTTGGTTTCACATAAAGGAGTTGAATTTTTTAGTAGA
TTTGACATATAAAAGAACGAATTGCTCTGTAAAGATTTGATAAAAAGTTATAACAAATTA
CCACTTAGTAATATTTCTAAACTTTTAGAGGACGAAGGAGTAATGATTCGTTCTAATATG
AAATTTTAAGTAAGAGTAAAAAAAGTAAAATATTTTAAAATACGTTTAAATTGTCTAAAT
TGTAAATAAGAATGGACTGTGGGATTGAAAAATTGTATAAATTGTAAAGGGTAACAAAGT
TATATTAGCTACAACATATAAGTTCTTGTTTAAGACTAACATTTTTTAGAATAGCAAGCA
TACATTTATCTCTACGATGATTTAGCAGCACAGTTCTTTAACATAACTGAAAGCGAAAAG
AAAGAACTGCACCTACACCTTACTAAAAATGAAACTTTTATATAGCTTTATTACAGCTTT
AATAAAGATTACCCACTATCTATTATTAAATTTAAAGATAAAATATTTAACAAAGATATT
ACTAATTGTATTGTTGCATATCCATTTGCAGATATAGATAACAAAATTTTCAATTCCTAG
TAATAAATCATTTAAGATGAAAATCTTAGGATAGAAAGTGAAAAATTTATTTAAAACTTT
ACAGAAGATAATAATTTGTAGGAATCTAAATTGTATTACGAAAAATTTAAAAGCAAAAAT
AAGCAACAAATTTTTGTAAATGGAACCTATATTTCTACAAATTACTCATAAGGATAAAAA
ATATGTTTAAAGCCTATTCCTTGTTTAAAAGTAATGTATGTGTTTCCACAAGAAGATATA
AAACTATCAGCCCTTAAAATTATAGAAGAAATAAACTAATTAAAAATACAAATAGATTAG
TTAAATTGA