Identifiers and Description

Gene Model Identifier

TTHERM_00318530

Standard Name

TAP65 (Telomerase- (or TERT-) associated protein of 65 kDa)

Aliases

PreTt21054 | 31.m00356 | 3687.m00157

Description

La domain containing protein; telomerase holoenzyme subunit p65; essential gene; functions to fold telomerase RNA prior to TERT binding; knockdown reduces telomerase RNP accumulation and induces telomere shortening

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF05383 ) La domain
  • ( PF03128 ) CXCXC repeat
  • ( PF07699 ) GCC2 and GCC3
  • ( PF00008 ) EGF-like domain
  • ( PF04438 ) HIT zinc finger
  • ( PF07974 ) EGF-like domain
  • ( TIGR01612 ) rhoptry protein
  • ( PF02363 ) Cysteine rich repeat
  • ( PF09257 ) BCMA, TALL-1 binding
  • ( PF00096 ) Zinc finger, C2H2 type
  • ( PF02425 ) Paralytic/GBP/PSP peptide
  • ( PF04702 ) Vicilin N terminal region
  • ( PF03940 ) Male specific sperm protein
  • ( PF08804 ) gp32 DNA binding protein like
  • ( PF00020 ) TNFR/NGFR cysteine-rich region
  • ( PF02420 ) Insect antifreeze protein repeat
  • ( PF03860 ) Domain of Unknown Function (DUF326)
  • ( PF08946 ) Osmosensory transporter coiled coil
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF06513 ) Repeat of unknown function (DUF1103)
  • ( PF03302 ) Giardia variant-specific surface protein
  • ( PF01826 ) Trypsin Inhibitor like cysteine rich
  • ( PF00228 ) Bowman-Birk serine protease inhibitor family
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00318530

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08344.19.997093137033517e-262hypothetical protein (2760 aa)
OxytrichaContig18862.0.g776.999881090205667e-34hypothetical protein
Stentor CoeruleusSteCoe_43401.7587922024243116e-25
WormBaseWBGene000022990.000009999254677478949locus:let-23 Receptor tyrosi
ne-protein kinase let-23 sta
tus:Confirmed UniProt:P24348
protein_id:CAA93882.3

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00318530(coding)
ATGTCCTGCAGTCATACTTGCAAAACATGCAGTGGAAATTCTTAAAAATGCTTATCTTGT
AATGATGGATTCTACATGGATAATACTTAAGCTACTCCCACTTGTTTGGGATGTTAAAAT
GATTGTAAGACTTGCAATAGCTCCCCAACTAGCTGTACAAGTTGTTTTGATGGTTATTTT
CTTAATGCAGCAAACAATTTATGTTAACCATGCGATTAGAAATGCCTTTTATGTTCTAAT
ACTTCTACAAATTGTAATTCTTGTATAGATGGATATTATGTATTAAATAACACTTGCTAA
ATATGTGATAAACCTTGTAAAACATGTTAAAATTTATCAACAAAGTGTACAAGCTGTTAT
AATAATTATTCTCTTGACAGCACCTAATTTAAATGCAATTTATGCTCAAATTTATGCAAA
ACATGCGATGGCTTAACCGGACTATGCACTAGCTGTTTAGATGGCTACTCACTTATATCT
GGTCAATGCTAATTATGCTAATTTCCATGCTCAACATGTGCATCTGGAAATGTAAATCTA
TGTTTATCTTGCTCTGGCAATTATTATTTAGACACAATTTTAAATATATGTAGTATTTGC
AGCAATAATTGTGTAAGCTGTGTAAGTTAATCAAATTGTTCTAAATGTCAAAATGGATAT
ATACTTGATGCTAATAATTAATGTATTGCATGCAGCTAAACTTGCAAAACTTGCAGCAAC
CAATTTAACCAATGCTTAAGCTGCTTTGATGGATATTATTTTGATAATTTGAACAAAGTA
TGCTCGCCTTGCATACCCGGATGCAAATAATGCAATAATTTGACTTCTTGTAATGTAGGA
TAATGTTTTGATCCTTATTTCTATGATACTACTTCGTAAACTTGCTTATAATGCAGTCCT
TAATGTTTGAGTTGTACTGGAAATAATAATTGTACAACTTGTGAAGATGGTTATGTTCTA
ATCTCAGGATCATGTGTATAATGTGATTAGGATTGTCGAAAATGTTCATAATCGACTGAT
AATTGCACAGATTGCTATTAAAATTTTAAATTAGTATAATTTTTTAGGAGCTATTGTTAT
TAAAAATATAGTTGCTCTTGTTCTCTTACAAAAGGAGTTTGTAATAGTTATAGTTATAAT
GATTGTGTATGTATGTAAGGATACTATAAAGTCTCATCAAATGCATGTAATAAATGCATA
TAGCATTGTTAAGATTGTACAGACGGATCTACCTGCACAAATTGCTTCCCCCCGTATGTA
AAAACTAATTTAAATACTTGTGTTTTGAATAAGTGCGATTCAACTTAATATTTTGATGGA
AGCTAATGTTAATTTTGTCCTCCTGGATGTTTAACATGTACTTCTAATTAAATATGCACT
AGTTGTATTAAAAGCTATTATTTGTAAACATAAGCTAATGGGAATATATAATGCTTACCT
TGCAAATATCCATGTGATACATGTGATAATGAAACAAGCTGTATTAGTTGTTTACCTAAT
TTTATTTTGTCTAATTCAAAATCATGCTAAAATTTATAAAATTGTAAATCGACTGACTCT
AACTCAAAATGTTCTACTTGTATTGATAAGTTTTATCTAGACTCAACATGCTAGCCATGT
GGAATACTTTGCTAAACTTGCAATAATTCGAATTCTTGTTTAACTTGTATTCCAGGATAT
TATTTAGATTCATAAAATTAATGCCAGCCTTGTAATTTCAATTGCTTAACCTGCTTAGAT
TAAAATGCTTGCACTTCATGCTTTGATTAAGGAATTTCTAGAGATGTTCCACCTTAATGT
TTATGCAAAAGTGGCTATTTTTAATTAGGGAGTTAGAATAAATGTTCACAATGTGACCCA
ACATGTTAACAATGTTCAAATTTATCAACTAATTGCTCTGCTTGTGATGCAAGTAAATTT
AGGATTTTAATACCAGGAGGATAATGTATATGTTAGCAAGGTTATTATGAAATATTTCAA
CCTTATAGATAATGCTTAGCATGTGATCCTACTTGTTTAGAATGTTATGGATCTGGTCCT
TAAAGATGCTTAAGTTGCAAATCAGGCTTCTATTTAAATCCTCTCTATACTTCGTGCTAA
TGCTAATAAGGATAATTTTTAAATTCGAACGGAGTATGTTAAAGTTGTTAAGTAGGTTGC
ATTTTATGCTAAAATTAAAGTTAATGTTTATAATGTGGTTTAAACATGTAAATTTCATAA
GATAAAACAACATGCTCTTGCTTAAAAGGATATTATCAAAATCAAGGTGTTTGCTAATAG
TGTGATGTTGCTTTTTGTGAAGATTGTTCTGCAAATAAATCTCAGTGCTTAAAATGCTTT
TCTGGAACACTTTAATCTTCTATTATATCAAAGTGTGAATGCTCTAGCAGTTCAAGCAAT
TAGTTTATTTCAAATTTAATGAGCTGCTCTTTATGTCATTTTTCTTGTGCTACATGTGAT
GGATTTGAAGCTCATAACTGTATTACTTGTCTTTCAAGCAGAAAATATAATTCTGTAACT
TCAACTTGTGAATGCAAGGATGGTACTTACGAAGATGACGCTTCTTAAAATTGCTTTAAA
TGTCATTATTCATGTTTCAAATGCAATGGCCCTTTTGAATCTGATTGCATAGAGTGTCCA
TAAAGCTCTACTACATTTAGGTAAATATCAGCAAATAGATAGCCATAAGATATTTCTTTT
AGGTGCACTTGTGCTCCAGGATATTTTGATGTTACTTAATAGCAAATATGTTAAAAATGT
AGTTATTAATGTTTAACTTGTATAGGGTTTGCTTCAAATTGTTAAAGTTGTTAGGTTACA
ATGAATAGAGTTTTGAGCTCAATTAATACGTGCATTTGTAGTAGCGGATACTTTGATGAT
GGTTTTAATTTTTAATGCCAAAAATGTCATTATACTTGTAAAAAGTGTATTAATGGTACT
AAATCTGGTTGTATAGAGTGTCCTGATAACTCATTTAGATATAGCTCATATAAAACTTTA
ACTGTTGATAATTCTTTTGAGTGCTTGTGCAACGAAAGATATTATGACGATGGTATTAAT
CCTGTATGTTAGAAATGCCACTACAGCTGTAAAAATTGTATTGGACCAAAAAATACTGAT
TGCATACAATGTGATCAAGTTATAGTATATTAAAGAATGTTTATTGCAAATATATCTTCA
CCAATTTCTTCAACTGGAATTTGCTAATGCGTTGATGGGTATTTTGATGATCTGACAAAT
ATTTTGTGTTAGAAATGCCCCTATCAATGCAAAACTTGTGATATTCAAAAATGCTTGACC
TGTGATATAACTAGAGATTTGGTTGGAATGACGTGCTAGTGTAAGAAAGGATACCTAGAA
GTAGGAAACTAGGCATGTGATTCTTGTAGTCCTTTGTGTTCAGAATGCAGTTAAACAAGA
TACAAATGTACAGCTTGTAATACTGCAATTACTTTTAGATAATTAAATTAACAGAACTCT
TGTCTTTGCTAAGAAGGTTATTTTGATGCCAGTAAATATGATTCAAAGACTAGAATACCT
ATATTAGAAATACCAAATTGCCTGAAATGCAAAAAAAACTGTAAGAGTTGTGGTCCTGAA
AATCCTAACATATGTTTATCTTGTTATTCTAATTACAACTATGTGTTGAATCCAGAAGAT
TTATGCGTTTGCATGTTTGGATTTGAAGAAAACAATAGTATTTGTGAGGAAAAATTTTTA
GTAAACAATTCATACATAGATGAGAGTAAATTAGATGCAATCAAAAGCATCATTTAAACT
TTACTCAGGATTATCAAAGTACTATCATGGATTCATTTATTAATGAATTAACCTTTCTAA
AGTTTGTTAGGGTTTAGACTTAATCTCATGTTAATTTATCTGAACTTTTGTAGTGTTAAA
GTAAGCAAAATAATACAAAATGTCACAGAGTTGCAAGAAATTGAAGATCCTTTTTCTATC
TTTAATTTTATGAACTTCATTAGCCCAAGCTATGAAGAAGTTAATAAAAGGAATCTACTG
AATAAAAGAATTTTCTTACAAAATAAACCTACAAGCTTTTTATAAAATGGGCAGGGATAC
TTTTTTTTATTTATATTGGTCCTCTTCATATATTTGATATTAAAATTAACGGTTTTGAGA
AAATCTGTTTTGATCTCATCTAAAATTTATCGAAAGCAAAAGTGGAGATATTAAATATAT
TAGATTGATCATAATATCATTTTTCCATTATTTATGACTCTTTTGCAGGTTTTAATGATA
AAGATATTTTTCTTCAGCTTGGTAGATATATTGACAACTTAGAGTTTTTCATATCCAGGT
TCAGCTATATCTTTGATTGCCTTAATTATTTATGGAATAGCTTACATATCTTGCATAGTA
TTTTTATATTTAATTAATAAAAATGAGGAGAACAAGTTAAAAAAATTTTTTGAATATGAC
CTAAACCCGAACTCTGCAAACTTCTTCTTTTTACAATTTTCTATTGATATATTGATTTGT
GCTTATTATGTAGTTTAATCGACAGATTTTAAATAGCAAACTATAATTATAATTCTTGGA
TATTTCGCACTTGGGTTTTTCGCCTTAATCTAAAAACCTTTTAAGCATTATTGGGAAAAT
TACCTTGAATTTATTTATTATGCAGGTCTCTCAACTGTAGTTATCCTTTTTTAGTAAGTA
GGATAGCTAACATTGACATAATTGATGAATGATAATCAATAGAAGCAATTTAATACCTCC
TCTTTTTATCTTGATTATTCTTTGATTGTGGCACTAATTATTAGTATAGCATGCATAACA
ATAAAGTTATCCAAAGGAATAATTAGAATTATGATTTTTATCAAAAAAATAAGAGAGTTT
AATTAGAGTGATACTGCTCTATGGGAAGTAGAAATTTTAGAAACTGAAAAAATTATTACC
TAGCACAGAAAATCACTCCTAATAACTGATTAATAGTAAATAAACAAAAATATTTTAAAA
GAAATTATGAATTCAGATCTTAACAGAAAAGAAACAAATTCTACTCAACATATGTAAACG
ATCACTCTAACTCCTCGAACTCCTGGTAAAAGATATCACCTATGA


>TTHERM_00318530(protein)
MSCSHTCKTCSGNSQKCLSCNDGFYMDNTQATPTCLGCQNDCKTCNSSPTSCTSCFDGYF
LNAANNLCQPCDQKCLLCSNTSTNCNSCIDGYYVLNNTCQICDKPCKTCQNLSTKCTSCY
NNYSLDSTQFKCNLCSNLCKTCDGLTGLCTSCLDGYSLISGQCQLCQFPCSTCASGNVNL
CLSCSGNYYLDTILNICSICSNNCVSCVSQSNCSKCQNGYILDANNQCIACSQTCKTCSN
QFNQCLSCFDGYYFDNLNKVCSPCIPGCKQCNNLTSCNVGQCFDPYFYDTTSQTCLQCSP
QCLSCTGNNNCTTCEDGYVLISGSCVQCDQDCRKCSQSTDNCTDCYQNFKLVQFFRSYCY
QKYSCSCSLTKGVCNSYSYNDCVCMQGYYKVSSNACNKCIQHCQDCTDGSTCTNCFPPYV
KTNLNTCVLNKCDSTQYFDGSQCQFCPPGCLTCTSNQICTSCIKSYYLQTQANGNIQCLP
CKYPCDTCDNETSCISCLPNFILSNSKSCQNLQNCKSTDSNSKCSTCIDKFYLDSTCQPC
GILCQTCNNSNSCLTCIPGYYLDSQNQCQPCNFNCLTCLDQNACTSCFDQGISRDVPPQC
LCKSGYFQLGSQNKCSQCDPTCQQCSNLSTNCSACDASKFRILIPGGQCICQQGYYEIFQ
PYRQCLACDPTCLECYGSGPQRCLSCKSGFYLNPLYTSCQCQQGQFLNSNGVCQSCQVGC
ILCQNQSQCLQCGLNMQISQDKTTCSCLKGYYQNQGVCQQCDVAFCEDCSANKSQCLKCF
SGTLQSSIISKCECSSSSSNQFISNLMSCSLCHFSCATCDGFEAHNCITCLSSRKYNSVT
STCECKDGTYEDDASQNCFKCHYSCFKCNGPFESDCIECPQSSTTFRQISANRQPQDISF
RCTCAPGYFDVTQQQICQKCSYQCLTCIGFASNCQSCQVTMNRVLSSINTCICSSGYFDD
GFNFQCQKCHYTCKKCINGTKSGCIECPDNSFRYSSYKTLTVDNSFECLCNERYYDDGIN
PVCQKCHYSCKNCIGPKNTDCIQCDQVIVYQRMFIANISSPISSTGICQCVDGYFDDLTN
ILCQKCPYQCKTCDIQKCLTCDITRDLVGMTCQCKKGYLEVGNQACDSCSPLCSECSQTR
YKCTACNTAITFRQLNQQNSCLCQEGYFDASKYDSKTRIPILEIPNCLKCKKNCKSCGPE
NPNICLSCYSNYNYVLNPEDLCVCMFGFEENNSICEEKFLVNNSYIDESKLDAIKSIIQT
LLRIIKVLSWIHLLMNQPFQSLLGFRLNLMLIYLNFCSVKVSKIIQNVTELQEIEDPFSI
FNFMNFISPSYEEVNKRNLLNKRIFLQNKPTSFLQNGQGYFFLFILVLFIYLILKLTVLR
KSVLISSKIYRKQKWRYQIYQIDHNIIFPLFMTLLQVLMIKIFFFSLVDILTTQSFSYPG
SAISLIALIIYGIAYISCIVFLYLINKNEENKLKKFFEYDLNPNSANFFFLQFSIDILIC
AYYVVQSTDFKQQTIIIILGYFALGFFALIQKPFKHYWENYLEFIYYAGLSTVVILFQQV
GQLTLTQLMNDNQQKQFNTSSFYLDYSLIVALIISIACITIKLSKGIIRIMIFIKKIREF
NQSDTALWEVEILETEKIITQHRKSLLITDQQQINKNILKEIMNSDLNRKETNSTQHMQT
ITLTPRTPGKRYHL


>TTHERM_00318530(gene)
ATGTCCTGCAGTCATACTTGCAAAACATGCAGTGGAAATTCTTAAAAATGCTTATCTTGT
AATGATGGATTCTACATGGATAATACTTAAGCTACTCCCACTTGTTTGGGATGTTAAAAT
GATTGTAAGACTTGCAATAGCTCCCCAACTAGCTGTACAAGTTGTTTTGATGGTTATTTT
CTTAATGCAGCAAACAATTTATGTTAACCATGCGATTAGAAATGCCTTTTATGTTCTAAT
ACTTCTACAAATTGTAATTCTTGTATAGATGGATATTATGTATTAAATAACACTTGCTAA
ATATGTGATAAACCTTGTAAAACATGTTAAAATTTATCAACAAAGTGTACAAGCTGTTAT
AATAATTATTCTCTTGACAGCACCTAATTTAAATGCAATTTATGCTCAAATTTATGCAAA
ACATGCGATGGCTTAACCGGACTATGCACTAGCTGTTTAGATGGCTACTCACTTATATCT
GGTCAATGCTAATTATGCTAATTTCCATGCTCAACATGTGCATCTGGAAATGTAAATCTA
TGTTTATCTTGCTCTGGCAATTATTATTTAGACACAATTTTAAATATATGTAGTATTTGC
AGCAATAATTGTGTAAGCTGTGTAAGTTAATCAAATTGTTCTAAATGTCAAAATGGATAT
ATACTTGATGCTAATAATTAATGTATTGCATGCAGCTAAACTTGCAAAACTTGCAGCAAC
CAATTTAACCAATGCTTAAGCTGCTTTGATGGATATTATTTTGATAATTTGAACAAAGTA
TGCTCGCCTTGCATACCCGGATGCAAATAATGCAATAATTTGACTTCTTGTAATGTAGGA
TAATGTTTTGATCCTTATTTCTATGATACTACTTCGTAAACTTGCTTATAATGCAGTCCT
TAATGTTTGAGTTGTACTGGAAATAATAATTGTACAACTTGTGAAGATGGTTATGTTCTA
ATCTCAGGATCATGTGTATAATGTGATTAGGATTGTCGAAAATGTTCATAATCGACTGAT
AATTGCACAGATTGCTATTAAAATTTTAAATTAGTATAATTTTTTAGGAGCTATTGTTAT
TAAAAATATAGTTGCTCTTGTTCTCTTACAAAAGGAGTTTGTAATAGTTATAGTTATAAT
GATTGTGTATGTATGTAAGGATACTATAAAGTCTCATCAAATGCATGTAATAAATGCATA
TAGCATTGTTAAGATTGTACAGACGGATCTACCTGCACAAATTGCTTCCCCCCGTATGTA
AAAACTAATTTAAATACTTGTGTTTTGAATAAGTGCGATTCAACTTAATATTTTGATGGA
AGCTAATGTTAATTTTGTCCTCCTGGATGTTTAACATGTACTTCTAATTAAATATGCACT
AGTTGTATTAAAAGCTATTATTTGTAAACATAAGCTAATGGGAATATATAATGCTTACCT
TGCAAATATCCATGTGATACATGTGATAATGAAACAAGCTGTATTAGTTGTTTACCTAAT
TTTATTTTGTCTAATTCAAAATCATGCTAAAATTTATAAAATTGTAAATCGACTGACTCT
AACTCAAAATGTTCTACTTGTATTGATAAGTTTTATCTAGACTCAACATGCTAGCCATGT
GGAATACTTTGCTAAACTTGCAATAATTCGAATTCTTGTTTAACTTGTATTCCAGGATAT
TATTTAGATTCATAAAATTAATGCCAGCCTTGTAATTTCAATTGCTTAACCTGCTTAGAT
TAAAATGCTTGCACTTCATGCTTTGATTAAGGAATTTCTAGAGATGTTCCACCTTAATGT
TTATGCAAAAGTGGCTATTTTTAATTAGGTAAAATACAAATCTTTCTTCTTAATTAAATT
ATAAAAAATATTTTCAATAAATTAGTATTTACTTTATTCACATATTTACTTATTTATTAA
TTATTTTTTGGTGCTTAGGGAGTTAGAATAAATGTTCACAATGTGACCCAACATGTTAAC
AATGTTCAAATTTATCAACTAATTGCTCTGCTTGTGATGCAAGTAAATTTAGGATTTTAA
TACCAGGAGGATAATGTATATGTTAGCAAGGTTATTATGAAATATTTCAACCTTATAGAT
AATGCTTAGCATGTGATCCTACTTGTTTAGAATGTTATGGATCTGGTCCTTAAAGATGCT
TAAGTTGCAAATCAGGCTTCTATTTAAATCCTCTCTATACTTCGTGCTAATGCTAATAAG
GATAATTTTTAAATTCGAACGGAGTATGTTAAAGTTGTTAAGTAGGTTGCATTTTATGCT
AAAATTAAAGTTAATGTTTATAATGTGGTTTAAACATGTAAATTTCATAAGATAAAACAA
CATGCTCTTGCTTAAAAGGATATTATCAAAATCAAGGTGTTTGCTAATAGTGTGATGTTG
CTTTTTGTGAAGATTGTTCTGCAAATAAATCTCAGTGCTTAAAATGCTTTTCTGGAACAC
TTTAATCTTCTATTATATCAAAGTGTGAATGCTCTAGCAGTTCAAGCAATTAGTTTATTT
CAAATTTAATGAGCTGCTCTTTATGTCATTTTTCTTGTGCTACATGTGATGGATTTGAAG
CTCATAACTGTATTACTTGTCTTTCAAGCAGAAAATATAATTCTGTAACTTCAACTTGTG
AATGCAAGGATGGTACTTACGAAGATGACGCTTCTTAAAATTGCTTTAAATGTCATTATT
CATGTTTCAAATGCAATGGCCCTTTTGAATCTGATTGCATAGAGTGTCCATAAAGCTCTA
CTACATTTAGGTAAATATCAGCAAATAGATAGCCATAAGATATTTCTTTTAGGTGCACTT
GTGCTCCAGGATATTTTGATGTTACTTAATAGCAAATATGTTAAAAATGTAGTTATTAAT
GTTTAACTTGTATAGGGTTTGCTTCAAATTGTTAAAGTTGTTAGGTTACAATGAATAGAG
TTTTGAGCTCAATTAATACGTGCATTTGTAGTAGCGGATACTTTGATGATGGTTTTAATT
TTTAATGCCAAAAATGTCATTATACTTGTAAAAAGTGTATTAATGGTACTAAATCTGGTT
GTATAGAGTGTCCTGATAACTCATTTAGATATAGCTCATATAAAACTTTAACTGTTGATA
ATTCTTTTGAGTGCTTGTGCAACGAAAGATATTATGACGATGGTATTAATCCTGTATGTT
AGAAATGCCACTACAGCTGTAAAAATTGTATTGGACCAAAAAATACTGATTGCATACAAT
GTGATCAAGTTATAGTATATTAAAGAATGTTTATTGCAAATATATCTTCACCAATTTCTT
CAACTGGAATTTGCTAATGCGTTGATGGGTATTTTGATGATCTGACAAATATTTTGTGTT
AGAAATGCCCCTATCAATGCAAAACTTGTGATATTCAAAAATGCTTGACCTGTGATATAA
CTAGGTAATAAATTTCTTTTAGTTTTTTATTTATTTGTTTGTTTGTTTATTAATAAATTA
ATTTTTTAATATGTATTTTATTTTATTACAGAGATTTGGTTGGAATGACGTGCTAGTGTA
AGAAAGGATACCTAGAAGTAGGAAACTAGGCATGTGATTCTTGTAGTCCTTTGTGTTCAG
AATGCAGTTAAACAAGATACAAATGTACAGCTTGTAATACTGCAATTACTTTTAGATAAT
TAAATTAACAGAACTCTTGTCTTTGCTAAGAAGGTTATTTTGATGCCAGTAAATATGATT
CAAAGACTAGAATACCTATATTAGAAATACCAAATTGCCTGAAATGCAAAAAAAACTGTA
AGAGTTGTGGTCCTGAAAATCCTAACATATGTTTATCTTGTTATTCTAATTACAACTATG
TGTTGAATCCAGAAGTAATTAATCAGTTTTTAACAGAAATAATTTTAAAAAATATTTTTT
GATTCGCTAAAAAATAGGATTTATGCGTTTGCATGTTTGGATTTGAAGAAAACAATAGTA
TTTGTGAGGAAAAATTTTTAGTAAACAATTCATACATAGATGAGAGTAAATTAGATGCAA
TCAAAAGCATCATTTAAACTTTACTCAGGATTATCAAAGTACTATCATGGATTCATTTAT
TAATGAATTAACCTTTCTAAAGTTTGTTAGGGTTTAGACTTAATCTCATGTTAATTTATC
TGAACTTTTGTAGTGTTAAAGTAAGCAAAATAATACAAAATGTCACAGAGTTGCAAGAAA
TTGAAGATCCTTTTTCTATCTTTAATTTTATGAACTTCATTAGCCCAAGCTATGAAGAAG
TTAATAAAAGGAATCTACTGAATAAAAGAATTTTCTTACAAAATAAACCTACAAGCTTTT
TATAAAATGGGCAGGGATACTTTTTTTTATTTATATTGGTCCTCTTCATATATTTGATAT
TAAAATTAACGGTTTTGAGAAAATCTGTTTTGATCTCATCTAAAATTTATCGAAAGCAAA
AGTGGAGATATTAAATATATTAGATTGATCATAATATCATTTTTCCATTATTTATGACTC
TTTTGCAGGTTTTAATGATAAAGATATTTTTCTTCAGCTTGGTAGATATATTGACAACTT
AGAGTTTTTCATATCCAGGTTCAGCTATATCTTTGATTGCCTTAATTATTTATGGAATAG
CTTACATATCTTGCATAGTATTTTTATATTTAATTAATAAAAATGAGGAGAACAAGTTAA
AAAAATTTTTTGAATATGACCTAAACCCGAACTCTGCAAACTTCTTCTTTTTACAATTTT
CTATTGATATATTGATTTGTGCTTATTATGTAGTTTAATCGACAGATTTTAAATAGCAAA
CTATAATTATAATTCTTGGATATTTCGCACTTGGGTTTTTCGCCTTAATCTAAAAACCTT
TTAAGCATTATTGGGAAAATTACCTTGAATTTATTTATTATGCAGGTCTCTCAACTGTAG
TTATCCTTTTTTAGTAAGTAGGATAGCTAACATTGACATAATTGATGAATGATAATCAAT
AGAAGCAATTTAATACCTCCTCTTTTTATCTTGATTATTCTTTGATTGTGGCACTAATTA
TTAGTATAGCATGCATAACAATAAAGTTATCCAAAGGAATAATTAGAATTATGATTTTTA
TCAAAAAAATAAGAGAGTTTAATTAGAGTGATACTGCTCTATGGGAAGTAGAAATTTTAG
AAACTGAAAAAATTATTACCTAGCACAGAAAATCACTCCTAATAACTGATTAATAGTAAA
TAAACAAAAATATTTTAAAAGAAATTATGAATTCAGATCTTAACAGAAAAGAAACAAATT
CTACTCAACATATGTAAACGATCACTCTAACTCCTCGAACTCCTGGTAAAAGATATCACC
TATGA