Identifiers and Description

Gene Model Identifier

TTHERM_01049190

Standard Name

TAP50 (Telomerase- (or TERT-) associated protein of 50 kDa)

Aliases

PreTt17677 | 211.m00045 | 3758.m00215

Description

Telomerase holoenzyme subunit p50; essential gene; knockdown induces telomere shortening

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR01885 ) ornithine--oxo-acid transaminase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.8%

TetraMine Data

TTHERM_01049190

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20440.13.9997566980151843e-38hypothetical protein (384 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01049190(coding)
ATGAAATTGTTACTTCAGAATTAGAATATTTTTCAAAAATTGAAGAATACCTTAAATGGA
TGCATCAAAAAATTTTATGATACATATTAAGATTTAGAACAGATGTAGAAGTTTGAAATG
ATTGTTGAGGACAAACTTCTTTTTAGATATTCTTGTAGTTAATCAGAAATGTTTTCAGCT
CAAATTTAAGCACACTATTTAGAAAAAAGAGTACTCTAATTAACTGATGGTAATGTTAAA
TATATAGTTAATTTTAGAGATAAAGGGGTTTTAGATAAAGCTAACTTTTTTGATACTCCA
AATAATAGCTTGGTTATTATAAGGCAGTGGAGCTATGAGATTTATTACACTAAAAATACT
TTTTAAATTAATCTAGTGATAGATGAAATGAGATGCATAGATATTATTACCACTATTTTT
TATTGCAAATTAGAATTAGATTTTACATAGGGGATTAAAGGGATTAGCAAGTCATCTTCT
TTTTCTAATTAGATTTATGAGTATTCAGCTCAATATTATAAAGCAATATAGTTATTAAAA
AAACTATTGATCAACGACTCTTATATTTCAGAGCTTTATAACTCAACTAAATCAAAATAA
TAGCCAAGACTTTTTATTTTTTAATCATTTAAGCCAAAAATGAATTTAGCCGAATAAAAC
TTAAGTAGATAATTTGAATAGTGTTAATAAGATGATTTTGGTGATGGTTGCTTATTATAA
ATAGTTAACTATACTCATTAAAGCCTAAAGTAAATAGAAAATAAAAATAATAGTAATTAA
ATAGTGAATGGTTAGAATGAAATAAGTAAAAAGAAAAGAGTTTTGAAAAGCAATGAAGAT
CTTTACAAAATTTCTTTATAAAAGTAATTAAAAATCTTTTAGGAAGAAGAAATAGAATTA
CATTCTTAATCCACTATCAGGAATTAAACAAATTAATAACTTGAAACTTTTGAATCAGAT
ACAAGCAAAAGAAACAGTGAAAAAATATTACACTCAATTAATGAACTCAATACTTCAAAA
CAAAAAGTTAATTAAATGAATAGTAGTTAACACTAAATATAAAAATTAGAAAACAATAAT
CTTAATAAAAACATTTTAAACTAAATAAATGAGAATGATATTAAAAATGAATTAGAAGAG
AGATAATAGTAACATCTAACATAATCATTCAATAGCAAAGCTCAATTAAAAAAAATAATT
ACATTAAAAAAAAATTAAGATATTTTATTATTTAAGCCTCAGGAATAAGAGGGTTCTAAA
AAATATTGA


>TTHERM_01049190(protein)
MKLLLQNQNIFQKLKNTLNGCIKKFYDTYQDLEQMQKFEMIVEDKLLFRYSCSQSEMFSA
QIQAHYLEKRVLQLTDGNVKYIVNFRDKGVLDKANFFDTPNNSLVIIRQWSYEIYYTKNT
FQINLVIDEMRCIDIITTIFYCKLELDFTQGIKGISKSSSFSNQIYEYSAQYYKAIQLLK
KLLINDSYISELYNSTKSKQQPRLFIFQSFKPKMNLAEQNLSRQFEQCQQDDFGDGCLLQ
IVNYTHQSLKQIENKNNSNQIVNGQNEISKKKRVLKSNEDLYKISLQKQLKIFQEEEIEL
HSQSTIRNQTNQQLETFESDTSKRNSEKILHSINELNTSKQKVNQMNSSQHQIQKLENNN
LNKNILNQINENDIKNELEERQQQHLTQSFNSKAQLKKIITLKKNQDILLFKPQEQEGSK
KY


>TTHERM_01049190(gene)
AGTTTTGATTTATTTTTCGCGGAATATTAAAGTAGTTTTAATTGCATTAAATAAATCAAT
AAATCAAATAAGATGAAATTGTTACTTCAGAATTAGAATATTTTTCAAAAATTGAAGAAT
ACCTTAAATGGATGCATCAAAAAATTTTATGATACATATTAAGATTTAGAACAGATGTAG
AAGTTTGAAATGATTGTTGAGGACAAACTTCTTTTTAGATATTCTTGTAGTTAATCAGAA
ATGTTTTCAGCTCAAATTTAAGCACACTATTTAGAAAAAAGAGTACTCTAATTAACTGAT
GGTAATGTTAAATATATAGTTAATTTTAGAGATAAAGGGGTTTTAGATAAAGCTAACTTT
TTTGATACTCCAAATAATAGCTTGGTTATTATAAGGCAGTGGAGCTATGAGATTTATTAC
ACTAAAAATACTTTTTAAATTAATCTAGTGATAGATGAAATGAGATGCATAGATATTATT
ACCACTATTTTTTATTGCAAATTAGAATTAGATTTTACATAGGGGATTAAAGGGATTAGC
AAGTCATCTTCTTTTTCTAATTAGATTTATGAGTATTCAGCTCAATATTATAAAGCAATA
TAGTTATTAAAAAAACTATTGATCAACGACTCTTATATTTCAGAGCTTTATAACTCAACT
AAATCAAAATAATAGCCAAGACTTTTTATTTTTTAATCATTTAAGCCAAAAATGAATTTA
GCCGAATAAAACTTAAGTAGATAATTTGAATAGTGTTAATAAGATGATTTTGGTGATGGT
TGCTTATTATAAATAGTTAACTATACTCATTAAAGCCTAAAGTAAATAGAAAATAAAAAT
AATAGTAATTAAATAGTGAATGGTTAGAATGAAATAAGTAAAAAGAAAAGAGTTTTGAAA
AGCAATGAAGATCTTTACAAAATTTCTTTATAAAAGTAATTAAAAATCTTTTAGGAAGAA
GAAATAGAATTACATTCTTAATCCACTATCAGGAATTAAACAAATTAATAACTTGAAACT
TTTGAATCAGATACAAGCAAAAGAAACAGTGAAAAAATATTACACTCAATTAATGAACTC
AATACTTCAAAACAAAAAGTTAATTAAATGAATAGTAGTTAACACTAAATATAAAAATTA
GAAAACAATAATCTTAATAAAAACATTTTAAACTAAATAAATGAGAATGATATTAAAAAT
GAATTAGAAGAGAGATAATAGTAACATCTAACATAATCATTCAATAGCAAAGCTCAATTA
AAAAAAATAATTACATTAAAAAAAAATTAAGATATTTTATTATTTAAGCCTCAGGAATAA
GAGGGTTCTAAAAAATATTGA