Identifiers and Description

Gene Model Identifier

TTHERM_00658760

Standard Name

TAP19 (Telomerase- (or TERT-) associated protein of 19 kDa)

Aliases

PreTt02161 | 97.m00147 | 3724.m00054

Description

TAP19 predicted protein; Telomerase holoenzyme subunit p19; essential gene; knockdown induces telomere shortening

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00658760

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16216.12.9993408039826107e-81hypothetical protein (196 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00658760(coding)
ATGGAAGAAATATATTGTTAAAATATTTTACAAAAGATAAGATTTTGTTTGGGAATCATT
AAAATTGAAAAAAAAGAAATGCAGTAGCCTAAGAGAAACTTTGATTTGTATAAACTCATT
ACAGACAAGTAGATAGATTTTTAAGTAGCTGATTTGATTCAAGATGAGTAGTCTTCATTT
GTTTCTGTACGCATTTATGGTCAATTTAAATGCTTTGTACCAAAAAGTACTATTTAAGAG
TAATTAGATAAAATAAAAAATTTATCTAGTAAAGAATTAGCTAAAAACAAAATATTTAAA
TTTCTCTCTGAGTACAATAAAAATAATTAAAAATAAGATGAACTATCTCATGATTACTAT
GGATACTTTAAGGTTTAGTAGCACCAATTTATACTCAATTTAGAAAATGCTCAAAGAGAA
GCAAGCTTGGCAGTAGATGATTTCTACTTTATTAATGGGAGAATTTATAAAACTAATCAC
GATATTTTGATTCTGCAAGCTCATCATGTATATTAAATGCAAAAACCTACTCTTTAATTG
CTTCAAGCTGCGTCAGAAATTAATCAAAATTGA


>TTHERM_00658760(protein)
MEEIYCQNILQKIRFCLGIIKIEKKEMQQPKRNFDLYKLITDKQIDFQVADLIQDEQSSF
VSVRIYGQFKCFVPKSTIQEQLDKIKNLSSKELAKNKIFKFLSEYNKNNQKQDELSHDYY
GYFKVQQHQFILNLENAQREASLAVDDFYFINGRIYKTNHDILILQAHHVYQMQKPTLQL
LQAASEINQN


>TTHERM_00658760(gene)
ATGAAGCCTAATTTAAGGATTTATATGTAAATTTTTTTATATTATTATTTAATCAATAAT
TTTTGATGTTGATTTTTATAATTTTTATGTGTATTTAAGAAAAAGATATTTTGCTTATTT
AGAATAAATATTTTAAAATGCATTAATTACACTTCATTTGAATTTAATTTAAAATTTTTT
TTCATTTTAAGTATTTAGTTAGAAATAAATCATTCAAAATGGAAGAAATATATTGTTAAA
ATATTTTACAAAAGATAAGATTTTGTTTGGGAATCATTAAAATTGAAAAAAAGTTAAAAA
TCCGCAAAATTTGATAATTTAGAAAAATTAAAATTGCTTTAAACAATTTAAAATAAGTGA
TTGTATTTGTTTTTATTATTAGAGAAATGCAGTAGCCTAAGAGAAACTTTGATTTGTATA
AACTCATTACAGACAAGTAGATAGATTTTTAAGTAGCTGATTTGATTCAAGATGAGTAGT
CTTCATTTGTTTCTGTACGCATTTATGGTCAATTTAAATGCTTTGTACCAAAAAGTACTA
TTTAAGAGTAATTAGATAAAATAAAAAATTTATCTAGTAAAGAATTAGCTAAAAACAAAA
TATTTAAATTTCTCTCTGAGTACAATAAAAATAATTAAAAATAAGATGAACTATCTCATG
ATTACTATGGATACTTTAAGGTTTAGTAGCACCAATTTATACTCAATTTAGAAAATGCTC
AAAGAGAAGCAAGCTTGGCAGTAGATGATTTCTACTTTATTAATGGGAGAATTTATAAAA
CTAATCACGATATTTTGATTCTGCAAGCTCATCATGTATATTAAATGCAAAAACCTACTC
TTTAATTGCTTCAAGCTGCGTCAGAAATTAATCAAAATTGA