Identifiers and Description

Gene Model Identifier

TTHERM_00526730

Standard Name

TAP1 (Tetrahymena Amino acid Permease )

Aliases

PreTt06411 | 66.m00210 | 3722.m00068

Description

Amino acid permease 1; similar to proton driven amino-acid pumps of the UNC-47/VGAT family

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00950 ) ABC 3 transport family
  • ( PF03845 ) Spore germination protein
  • ( PF07672 ) Mycoplasma MFS transporter
  • ( TIGR02614 ) cell division protein FtsW
  • ( PF01148 ) phosphatidate cytidylyltransferase
  • ( PF07695 ) 7TM diverse intracellular signalling
  • ( PF00001 ) 7 transmembrane receptor (rhodopsin family)
  • ( PF01490 ) Transmembrane amino acid transporter protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00526730

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13414.19.997093137033517e-262transmembrane amino acid trans
porter (552 aa)
OxytrichaContig4642.0.g783.998693556225637e-29Transmembrane amino acid trans
porter protein
SGDYNL101W7.996210139153865e-29AVT4 Vacuolar transporter, exp
orts large neutral amino acids
from the vacuole; member of a
family of seven S. cerevisiae
genes (AVT1-7) related to ves
icular GABA-glycine transporte
rs
WormBaseWBGene000128043.9989916100764785e-24status:Confirmed UniProt:O45
936 protein_id:CAA16336.2
DictyBaseDDB_G02930740.0007999190683310628DDB_G0293074 on chromosome: 6
position 2437739 to 2439363

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:12456006: Haddad A, Bowman GR, Turkewitz AP (2002) New class of cargo protein in Tetrahymena thermophila dense core secretory granules. Eukaryotic cell 1(4):583-93
  2. Ref:17821280: Harrison JA, Fowler EH (1945) AN ANTIGEN-ANTIBODY REACTION WITH TETRAHYMENA WHICH RESULTS IN DYSTOMY. Science (New York, N.Y.) 102(2638):65-6

Sequences

>TTHERM_00526730(coding)
ATGAAGTCCAATAAAAAGTAGTAGAAAAGATAATAAGAAAGGCATGACGACCCAGATTTA
GAGCCCTTGAACAAAAAAAACGATGAATAAGTTATAGAAACTGATGAGGGCGTAATTAAG
AATCGCAGTTCATAAAAAGAAGAAAAAAAGAGCTACTAATCAAATTAGAGTGATGGAAGT
AGAATATAAAAAAGATAATCTCAAGATCAAGAAAATTGGAGTGATGATTCAGCAGAAGAA
GCTAATTAAATTGATGACTTGAAACATGAAGAAAAGGCTGATGTTTGGAATGCAACTATA
AATATGGTTAAGGGATTTGTTGGAATCGGTATTTTAGCACTACCTTCAGGTTTTGCTAAG
AGTGGTTGGTTGGGAGGATTAATAATTTTTTTGCTTTGCGCTGGAATGGTTCTTTATTTA
AGTTTATAGATGATGGATGCAGCAAACAAAAGAAAATCTTAAGCTAGAGGTGTTACCTAA
TTCAGTGTTGAAGTTTTGGGATAAGAAAAAGAATTATTAGTTAATATATTTTTATTTGGA
ATCTAAATTGGAATTTGTGTTGCCTATGTTATTTTCTTCACTACTTATTTTTAAGAGAGT
CTTTGTTTCTTTGTAGATTATGATCGTACAACTAATGTATGTGGTTCAAGAGTTCCTTCG
TTACTCATTTCACTTATAATCGTTACTCCTACAATATTTATCAGACACATGAGTAAACTT
AAAACTTGGAGCATGTTTTCAAATAGTTTAATTCTTATTAGTATGCTTGTAGTATTTATT
TCTTGCTTTTTTAAAATGGACACTTCTTACATTACTAGTGACAAAATTTCAGCTATCAGA
TGGGGAGAAATGGGTAGTGCAATAGGTTTATTTGTGTTTGCATTTGAAGGAACCACTCTT
TATTTTGAAATTAGGAGTTCTATGCAAGAACCAACTGAGTTCAAAAAGGTTCTTAATTAT
TCTCTTTATATTGGTATTGCTCTTTATGGGTGCATTGGTTTGAGTGGATATTTAGCTTTT
GGATCAGGTGTTAGAGACATCATACTTTTTAATTTCCCTATGACTAATCCCTTGTATGTT
TTTATTTAAATCTTTTACTGTATAGCAATATTGTTATCCTATCCTCTTCAGATGTTCCCT
TTAGTCAATATCTTAGAATAAAAATTATTAGAAAGGATAGTCAATGAAAAGAATAAATAA
AAAACAAATAGCTAGCCCTAAAAAAAGTCATAGCAAGGTGTAGATTAAAGCCAACATCAT
AATTAAGGTAATCAGCAAGCAGACGATAGATAAGATAACTAGGAATCTGATGCATCAGAA
GGAAATGCATTGAACTTATTAACATAATATGATGATGAAATAAAAAATTCATTTTACTAA
TAAAGCATGATATTAAGAGTAGCTTCTCTTTTATTCATATTCTTTTTTGCAATCGTCTTT
AAAAGACTAACTGTCTTTTTAAATTTAATTGGTTCTATTGGTGGTTGCTTTTTTGCATTT
ATTTTACCAGTCATTGTCTATGAGTATTCTATGCCAGAAGCTTCACAAAAAAAAATATAC
TTTCACAGAGGCTTACTTGTACTAGGTGTTATTTTTTCCTTCTTTGGTACTCTTTCTAGT
TTAAGAGATATCTATAGATCGTTATGA


>TTHERM_00526730(protein)
MKSNKKQQKRQQERHDDPDLEPLNKKNDEQVIETDEGVIKNRSSQKEEKKSYQSNQSDGS
RIQKRQSQDQENWSDDSAEEANQIDDLKHEEKADVWNATINMVKGFVGIGILALPSGFAK
SGWLGGLIIFLLCAGMVLYLSLQMMDAANKRKSQARGVTQFSVEVLGQEKELLVNIFLFG
IQIGICVAYVIFFTTYFQESLCFFVDYDRTTNVCGSRVPSLLISLIIVTPTIFIRHMSKL
KTWSMFSNSLILISMLVVFISCFFKMDTSYITSDKISAIRWGEMGSAIGLFVFAFEGTTL
YFEIRSSMQEPTEFKKVLNYSLYIGIALYGCIGLSGYLAFGSGVRDIILFNFPMTNPLYV
FIQIFYCIAILLSYPLQMFPLVNILEQKLLERIVNEKNKQKTNSQPQKKSQQGVDQSQHH
NQGNQQADDRQDNQESDASEGNALNLLTQYDDEIKNSFYQQSMILRVASLLFIFFFAIVF
KRLTVFLNLIGSIGGCFFAFILPVIVYEYSMPEASQKKIYFHRGLLVLGVIFSFFGTLSS
LRDIYRSL


>TTHERM_00526730(gene)
ATGAAGTCCAATAAAAAGTAGTAGAAAAGATAATAAGAAAGGCATGACGACCCAGATTTA
GAGCCCTTGAACAAAAAAAACGATGAATAAGTTATAGAAACTGATGAGGGCGTAATTAAG
AATCGCAGTTCATAAAGTAAGGAGAAGATCTTTAAATATTTTAAAGAATTGTTAATAATC
ATTTTATTTGATTATTTGGAATTTATTTTTTTTATATAATTTCAAAGAAGAAGAAAAAAA
GAGCTACTAATCAAATTAGAGTGATGGAAGTAGAATATAAAAAAGATAATCTCAAGATCA
AGAAAATTGGAGTGATGATTCAGCAGAAGAAGCTAATTAAATTGATGACTTGAAACATGA
AGAAAAGGCTGATGTTTGGAATGCAACTATAAATATGGTTAAGGGATTTGTTGGAATCGG
TATTTTAGCACTACCTTCAGGTTTTGCTAAGAGTGGTTGGTTGGGAGGATTAATAATTTT
TTTGCTTTGCGCTGGAATGGTTCTTTATTTAAGTTTATAGATGATGGATGCAGCAAACAA
AAGAAAATCTTAAGCTAGAGGTGTTACCTAATTCAGTGTTGAAGTTTTGGGATAAGAAAA
AGAATTATTAGTTAATATATTTTTATTTGGAATCTAAATTGGAATTTGTGTTGCCTATGT
TATTTTCTTCACTACTTATTTTTAAGAGAGTCTTTGTTTCTTTGTAGATTATGATCGTAC
AACTAATGTATGTGGTTCAAGAGTTCCTTCGTTACTCATTTCACTTATAATCGTTACTCC
TACAATATTTATCAGACACATGAGTAAACTTAAAACTTGGAGCATGTTTTCAAATAGTTT
AATTCTTATTAGTATGCTTGTAGTATTTATTTCTTGCTTTTTTAAAATGGACACTTCTTA
CATTACTAGTGACAAAATTTCAGCTATCAGATGGGGAGAAATGGGTAGTGCAATAGGTTT
ATTTGTGTTTGCATTTGAAGGAACCACTCTTTATTTTGAAATTAGGTAAATTTATTTCAC
AAAAATTTTTTTAAATAATTTTTTAAAATAACAATTTTTTTCAAATTAATAGGAGTTCTA
TGCAAGAACCAACTGAGTTCAAAAAGGTTCTTAATTATTCTCTTTATATTGGTATTGCTC
TTTATGGGTGCATTGGTTTGAGTGGATATTTAGCTTTTGGATCAGGTGTTAGAGACATCA
TACTTTTTAATTTCCCTATGACTAATCCCTTGTATGTTTTTATTTAAATCTTTTACTGTA
TAGCAATATTGTTATCCTATCCTCTTCAGATGTTCCCTTTAGTCAATATCTTAGAATAAA
AATTATTAGAAAGGATAGTCAATGAAAAGAATAAATAAAAAACAAATAGCTAGCCCTAAA
AAAAGTCATAGCAAGGTGTAGATTAAAGCCAACATCATAATTAAGGTAATCAGCAAGCAG
ACGATAGATAAGATAACTAGGAATCTGATGCATCAGAAGGAAATGCATTGAACTTATTAA
CATAATATGATGATGAAATAAAAAATTCATTTTACTAATAAAGCATGATATTAAGAGTAG
CTTCTCTTTTATTCATATTCTTTTTTGCAATCGTCTTTAAAAGACTAACTGTCTTTTTAA
ATTTAATTGGTTCTATTGGTGGTTGCTTTTTTGCATTTATTTTACCAGTCATTGTCTATG
AGTATTCTATGCCAGAAGCTTCACAAAAAAAAATATACTTTCACAGAGGCTTACTTGTAC
TAGGTGTTATTTTTTCCTTCTTTGGTACTCTTTCTAGTTTAAGAGATATCTATAGATCGT
TATGA