Identifiers and Description

Gene Model Identifier

TTHERM_00787360

Standard Name

TAF6 (TATA Binding Protein Associated Factor 6)

Aliases

PreTt08563 | 132.m00122 | 3755.m00482

Description

TATA box binding protein associated factor, one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID)complex

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

  • obsolete transcription initiation factor activity (IEA) | GO:0016986

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11%

TetraMine Data

TTHERM_00787360

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18751.19.997093137033517e-262TATA box binding protein assoc
iated factor (532 aa)
SGDYGL112C0.000000000000001999258566166494TAF6 Subunit (60 kDa) of TFIID
and SAGA complexes, involved
in transcription initiation of
RNA polymerase II and in chro
matin modification, similar to
histone H4
DictyBaseDDB_G02884710.000000000003998907168546896taf6 on chromosome: 5 position
1566143 to 1567864
OxytrichaContig10658.0.g470.000030009396760408108TATA box binding protein assoc
iated factor (TAF)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00787360(coding)
ATGGCTGAACTACGTGATAATAATTTTGTTTTAGAGTTACTTAAAGGATTTAGTATTGAT
AAAGTTGATAAGGAAATATCACAAGAAATATGCAATTAAGTTGAAATTGAATTAAGATCT
TTGATCGAAGATTCCATTAAATTTATGAAACATTTTAAAAGAGATAAACTGACTACTTCT
GATGTTGAATACGCTTTGAAAGATAGAAACTACTACGATAAAATATTTGGATATGATGTT
TCTGAAAAGGTTTCGTTTAAGAAGCATGCTAATTATTGGATAAAATAAGATGAAGAAAGG
GACTTATAGAGTTACCTAGAAGCTCAAGTAAAGAGCTTAAAAAGATAAGTAATGTAGCCA
ACTGTTACAGCTTGGTGGATGTCTATTGATGGTAAAATACCTCCTATCAACGAAAACAAA
TTCATTAAAAATAAGGCTGCTATTTTAAAATATGATGAGCTTAAAAAAGAAGAATATTCT
AAAAACTTTAATATCATCAAGGATAAACCAAGATCTCTATTAAGTGAAGAAATCAATAAG
TTTTTTGTTGAAATAACAAAAGTCATAGCCGAAACTGAAGAGCAAATCGACAATCCTAAA
TTAAATCTTCCAGGTGCCCCTTTTAGAGAAACTCCCAAACTTAAAATTATTTTGAATAAC
TTGAAGACAAACAGTGGTTTAACAAGTTTGCTTCCATTTTTGTTAAATTATTTGTATTAG
GACTATGACTTAGAGAACAAAAATGGAGTTTCTAAAAAATACATTACATTAAAAATACTA
CATTCTATCATTTTAAATACTGGCATAAATATAGAATTCCATTTGCACATAATTATTAAA
ATCTTAATTCATTTCATAACTGCTTCAGTATTGAGTACAAACAAATGTGTGGACGAAATT
CAGTTTAGAGAGCAAAGTGCACAAAATCTCTCATATCTAATAAACAGATTCACTTTTAAA
TACATAACTTTAAAGTAAAACATTTGTGACACACTTCTAGGTATTCTTAAAGAAACTCTC
AATTAAAAAATTCTCAATTACTAAGTTTTACTGGGTATAGTTATGACATTCAGTCACTTT
GAATCTAATATCATAAGGCAATTAATTTTACCAACAATAATGCAAATTTTCATGAATGAA
GATTTCAGAAAAGATTTAAATTGCTTAGCTTCTATTAATTTACGCTCGTAACAAAGAAGC
GAGTATATAAATTTATAAAACTAAAATAGTATGGAAATCGAGCAATAATCCAAACCAAAT
AATACTGAAGAAAATGATAAGGTAAAAAAGTAAAAAATCATTAAGGAAAATATATAAAAA
GTTATTAAAAACAACAACGAAGCACACAGCCTCTTGAACGAGTTAAAGCTTCTGGTTTTA
AAGGTTTTCAATGAATATTCATTTGCTACAAGCAAAACTGAGGCTCTTCTATTTTAAGAA
TTAGAAGAATAATTTATTACCGAGCTCAATCCTCTAGTAATTAGACTCATCTATAATAAT
ATGCCAATATAATTAAAATACTTAGACGAAAGATAATATAATCCTTCCTATATGAATTTA
ATGCTTTGA


>TTHERM_00787360(protein)
MAELRDNNFVLELLKGFSIDKVDKEISQEICNQVEIELRSLIEDSIKFMKHFKRDKLTTS
DVEYALKDRNYYDKIFGYDVSEKVSFKKHANYWIKQDEERDLQSYLEAQVKSLKRQVMQP
TVTAWWMSIDGKIPPINENKFIKNKAAILKYDELKKEEYSKNFNIIKDKPRSLLSEEINK
FFVEITKVIAETEEQIDNPKLNLPGAPFRETPKLKIILNNLKTNSGLTSLLPFLLNYLYQ
DYDLENKNGVSKKYITLKILHSIILNTGINIEFHLHIIIKILIHFITASVLSTNKCVDEI
QFREQSAQNLSYLINRFTFKYITLKQNICDTLLGILKETLNQKILNYQVLLGIVMTFSHF
ESNIIRQLILPTIMQIFMNEDFRKDLNCLASINLRSQQRSEYINLQNQNSMEIEQQSKPN
NTEENDKVKKQKIIKENIQKVIKNNNEAHSLLNELKLLVLKVFNEYSFATSKTEALLFQE
LEEQFITELNPLVIRLIYNNMPIQLKYLDERQYNPSYMNLML


>TTHERM_00787360(gene)
ATGGCTGAACTACGTGATAATAATTTTGTTTTAGAGTTACTTAAAGGATTTAGTATTGAT
AAAGTTGATAAGGAAATATCACAAGAAATATGCAATTAAGTTGAAATTGAATTAAGATCT
TTGATCGAAGTAGAAATTTTAAAATCTAATTTGTTGATAATTAGTTATTCAATCAATATT
AATAAATGAATGATATCTTAAATTATTAATTTGAGATAAATCTTTATCAAGCAAATCATT
TTAAAGCAGTTTTAAATCTATTTTATATTTAAAATGTGTAGGATTCCATTAAATTTATGA
AACATTTTAAAAGAGATAAACTGACTACTTCTGATGTTGAATACGCTTTGAAAGATAGAA
ACTACTACGATGTAATTATTTCATTTAGCTAAAAAAAGCAACCTAGTTAATAAATATGAT
ATATTTAATCTTGCTGAAAGATAATTTTGATTTTAAATTAATTAGAAAATATTTGGATAT
GATGTTTCTGAAAAGGTTTCGTTTAAGAAGCATGCTAATTATTGGATAAAATAAGATGAA
GTAAATAATAAAATATCTATAAATCTATCTTTTTATATCGAATTGCACATTAAAAAGTGC
GCAATTTAGTGTATTTTAAATATCCTTTAATATTAATAAAGGAAAGGGACTTATAGAGTT
ACCTAGAAGCTCAAGTAAAGAGCTTAAAAAGATAAGTAATGTAGCCAACTGTTACAGCTT
GGTGGATGTCTATTGATGGTAAAATACCTCCTATCAACGAAAACAAATTCATTAGTAATT
AATTAGCTAAAAAATATGAATGAATATCTCTATTTAAATATTTTAAATTTGTAGAAAATA
AGGCTGCTATTTTAAAATATGATGAGCTTAAAAAAGAAGAATATTCTAAAAACTTTAATA
TCATCAAGGATAAACCAAGATCTCTATTAAGTGAAGAAATCAATAAGTTTTTTGTTGAAA
TAACAAAAGTCATAGCCGAAACTGAAGAGCAAATCGACAATCCTAAATTAAATCTTCCAG
GTGCCCCTTTTAGAGAAACTCCCAAACTTAAAATTAGTAAACCAAATAAAAATTTTTCTT
AACAAATTACTATATTGAAAATATTTTAAACATAAAAAAGTTTTGAATAACTTGAAGACA
AACAGTGGTTTAACAAGTTTGCTTCCATTTTTGTTAAATTATTTGTATTAGGACTATGAC
TTAGAGAACAAAAATGGAGTTTCTAAAAAATACATTACATTAAAAATACTACATTCTATC
ATTTTAAATACTGGCATAAATATAGAATTCCATGTAAATTAATTAACATTCATTTTTTAT
TTATTTGGAGATTTTAAATAGTTAATTTTATGCTTATTAAAATTAGTTGCACATAATTAT
TAAAATCTTAATTCATTTCATAACTGCTTCAGTATTGAGTACAAACAAATGTGTGGACGA
AATTCAGTTTAGAGAGCAAAGTGCACAAAATCTCTCATATCTAATAAACAGATTCACTTT
TAAATACATAACTTTAAAGTAAAACATTTGTGACACACTTCTAGGTATTCTTAAAGAAAC
TCTCAATTAAAAAATTCTCAATTACTAAGTTTTACTGGGTATAGTTATGACATTCAGTCA
CTTTGAATCTAATATCATAAGGCAATTAATTTTACCAACAATAATGCAAATTTTCATGAA
TGAAGATTTCAGAAAAGATTTAAATTGCTTAGCTTCTATTAATTTACGCTCGTAACAAAG
AAGCGAGTATATAAATTTATAAAACTAAAATAGTATGGAAATCGAGCAATAATCCAAACC
AAATAATACTGAAGAAAATGATAAGGTAAAAAAGTAAAAAATCATTAAGGAAAATATATA
AAAAGTTATTAAAAACAACAACGAAGCACACAGCCTCTTGAACGAGTTAAAGGTATTCAT
TTATTTATTTAAGAATTACTTTTTTTTTAATTAATGTATAATAATTTTATAAAGCTTCTG
GTTTTAAAGGTTTTCAATGAATATTCATTTGCTACAAGCAAAACTGAGGCTCTTCTATTT
TAAGAATTAGAAGAATAATTTATTACCGAGCTCAATCCTCTAGTAATTAGACTCATCTAT
AATAATATGCCAATATAATTAAAATACTTAGACGAAAGATAATATAATCCTTCCTATATG
AATTTAATGCTTTGA