Identifiers and Description

Gene Model Identifier

TTHERM_00170240

Standard Name

TAD3 (tRNA-specific adenosine deaminase 3)

Aliases

PreTt29735 | 14.m00302

Description

tRNA-specific adenosine deaminase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF07337 ) DC-EC Repeat
  • ( PF00383 ) Cytidine and deoxycytidylate deaminase zinc-binding

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00170240

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09990.12.9988266274323582e-173cytidine and deoxycytidylate d
eaminase zinc-binding region f
amily protein (356 aa)
DictyBaseDDB_G02788410.0000000000010000211161514907DDB_G0278841 on chromosome: 3
position 1265394 to 1267160
WormBaseWBGene000129270.000000000010004361180063202status:Confirmed UniProt:Q9N
AH8 protein_id:CAB55073.2
SGDYLR316C0.00000000019994075865167896TAD3 Subunit of tRNA-specific
adenosine-34 deaminase, forms
a heterodimer with Tad2p that
converts adenosine to inosine
at the wobble position of seve
ral tRNAs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00170240(coding)
ATGCAATAACTACTTCCTAAAGAATTTTTGGCATCTGCTAACATTTAGCAAGCGATAGTC
ATTGAATTTGAAAACAAGAAAACAAATGTTATGATTAAAAAATACGGAAACGACTAATAT
TTTAATTTAAAGAATCTGAATCATATCAAGAGGATCAGAAAGTCTGAAGAAAACCCATCA
AATGTCTAATTTTTTCTGAGATTAAAAGATGATTTTAATGAAGAGGTAGAGTAAAACATC
CCTGAAGAAATCAATCCATATTCTTTAAAAGAAGTGGAGGTTGCTGTAAACATACCAAGG
ACAAAGGAATAATATTAGCAATTTAACAAGTATTGGCCTATTACCTATAAAGTATAGCAG
TATGAAATAGTGCAGTTTACTGATTTTGAATAGTAAGAAATTAATCAAGTAATGAGATAA
TGCATTGATTAAGCCAAGCAAACGTATGAAAAAAATAATAAATTTAATGCATGTGCCATT
TATGATCCAATTAAAAAGAAAATCCTTTAATTTGCAGTTGATGAAACTTGCAGAAAGCAA
AATAGCATTAAACATTGTACTATGAATGTTATGAAGCTATTTGGCTAAAATTATATAGTA
ACTGCCTAGCAAAAAGCAAGTATTGAAAAAGTCAAAGACAAACAAGATGATACGATTGAA
GTAAAATAAGAATCATAATTAAATGCTAGCTAATAAGAAAAAAAGTAGCCTGATACACTT
GAATAAGAATAAGAAGAAGAGAAGAAAGATAAAATTAACAGCAAAAGAAAAAGTGAAGAA
AGCATTGAAGAATCTTTATCATCTTATTATTATTGCACTGGTTTAGATATTTTCATTGTT
TAAGAACCCTGTATTATGTGCTCAATGGCTTTAATCCATTCAAGAGTAAGAAGAGTATAT
TATTCACTTAAAAACCCTAAGCAGGAGCAATTTGGTGGGTTGAATGAGGATCTAATGATT
AACCACATGGATTCTCTCAATCATTCTTTCCTAGTTTTCTAAAATGTAGAGTCTGAATAT
GCAAATACCACTTTGAACAACTTAAAGCAACAAGATGAGTTGCAAAAATGA


>TTHERM_00170240(protein)
MQQLLPKEFLASANIQQAIVIEFENKKTNVMIKKYGNDQYFNLKNLNHIKRIRKSEENPS
NVQFFLRLKDDFNEEVEQNIPEEINPYSLKEVEVAVNIPRTKEQYQQFNKYWPITYKVQQ
YEIVQFTDFEQQEINQVMRQCIDQAKQTYEKNNKFNACAIYDPIKKKILQFAVDETCRKQ
NSIKHCTMNVMKLFGQNYIVTAQQKASIEKVKDKQDDTIEVKQESQLNASQQEKKQPDTL
EQEQEEEKKDKINSKRKSEESIEESLSSYYYCTGLDIFIVQEPCIMCSMALIHSRVRRVY
YSLKNPKQEQFGGLNEDLMINHMDSLNHSFLVFQNVESEYANTTLNNLKQQDELQK


>TTHERM_00170240(gene)
TGAAAATTAAATATATAAATTAAAAATAAATAAATTTGTTCTATAAATGCAATAACTACT
TCCTAAAGAATTTTTGGCATCTGCTAACATTTAGCAAGCGATAGTCATTGAATTTGAAAA
CAAGAAAACAAATGTTATGATTAAAAAATACGGAAACGACTAATATTTTAATTTAAAGAA
TCTGAATCATATCAAGAGGATCAGAAAGTCTGAAGAAAACCCATCAAATGTCTAATTTTT
TCTGAGATTAAAAGATGTATCAAGTAATTAAAGTAGATGTATAAATAATCTATAATTTAT
ATTTAAAAGGATTTTAATGAAGAGGTAGAGTAAAACATCCCTGAAGAAATCAATCCATAT
TCTTTAAAAGAAGTGGAGGTTGCTGTAAACATACCAAGGACAAAGGTAAGCTTAAAATAA
TTATATGGAATAAATAAATAAATTAAGAATTGCCTTTATTTTAGTATTAAATTAATAAAG
CTTTTTTGAATATACTTAGGAATAATATTAGCAATTTAACAAGTATTGGCCTATTACCTA
TAAAGTATAGCAGTATGAAATAGTGCAGTTTACTGATTTTGAATAGTAAGAAATTAATCA
AGTAATGAGATAATGCATTGATTAAGCCAAGCAAACGTATGAAAAAAATAATAAATTTAA
TGCATGTGCCATTTATGATCCAATTAAAAAGAAAATCCTTTAATTTGCAGTTGATGAAAC
TTGCAGAAAGCAAAATAGCATTAAACATTGTACTATGAATGTTATGAAGCTATTTGGCTA
AAATTATATAGTAACTGCCTAGCAAAAAGCAAGTATTGAAAAAGTCAAAGACAAACAAGA
TGGTAAACAAACAAATAAACATTTAAGCATTTGCAAATTGAAATTTAAAAAATATAAATT
ATTTACTCATTTAAAAACAAGATACGATTGAAGTAAAATAAGAATCATAATTAAATGCTA
GCTAATAAGAAAGTATTCATAAATTATTTTATATAATTATTTGAAATAAAAAACTAAAAA
AGAAGAAAAGTAGCCTGATACACTTGAATAAGAATAAGAAGAAGAGAAGAAAGATAAAAT
TAACAGCAAAAGAAAAAGTGAAGAAAGCATTGAAGAATCTTTATCATCTTATTATTATTG
CACTGGTTTAGATATTTTCATTGTTTAAGAACCCTGTATTATGTGCTCAATGGCTTTAAG
TAATTACTTAATAATATTTAAACTAGATATTTTTAGGATTATTTGAAATATTAAAAGCAT
TTAAATATTTATTAATTGATTAATGATATTTTATTATTTTTATTTCATAAAATAACAAAC
AATTTTAACTAACTATCTTTTAATAAATGCCTTACAAAATCAATTATGAATTATTCATTT
AATTAGTCCATTCAAGAGTAAGAAGAGTATATTATTCACTTAAAAACCCTAAGCAGGAGC
AATTTGGTGGGTTGAATGAGGATCTAATGATTAACCACATGGATTCTCTCAATCATTCTT
TCCTAGTTTTCTAAAATGTAGAGTCTGAATATGCAAATACCACTTTGAACAACTTAAAGC
AACAAGATGAGTTGCAAAAATGATTTTATCATCTCTGGCCTTTCACTAATTTCTTCATAA
ATTTACGAGAGAATCATTTATTTTTTAATATTTTCAAAGCTTGAGATTTTTTAACTTTAT
AGTATTTATTTATAACAAACAGTTAAAAATAGTTTAAATTAT