Identifiers and Description

Gene Model Identifier

TTHERM_00389830

Standard Name

TAD1 (tRNA-specific adenosine deaminase 1)

Aliases

PreTt24879 | 41.m00286

Description

tRNA-specific adenosine deaminase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF02137 ) Adenosine-deaminase (editase) domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.8%

TetraMine Data

TTHERM_00389830

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04514.19.997093137033517e-262adenosine deaminase (420 aa)
DictyBaseDDB_G02789432.0004286606204839e-16DDB_G0278943 on chromosome: 3
position 1240717 to 1242542
SGDYGL243W0.0000000000019997478866288316TAD1 tRNA-specific adenosine d
eaminase, deaminates adenosine
-37 to inosine in tRNA-Ala
WormBaseWBGene000000800.00000000006996681903814525locus:adr-2 Probable double-
stranded RNA-specific adenosin
e deaminase status:Confirmed
UniProt:Q22618 protein_id
:CCD73351.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00389830(coding)
ATGCATTACATAGAGTAATTAAATCTACTGAATCCCATAATTAAAGAGTGCTTGAGCAGT
AAGCAAAAGAATGGCAAGATAATTAAGATAAAATGGAAATAGAAAGTGCCTCTATACAAA
ATACCTAAAAACAATAAAAAAAGCTACATAGAGGAGCTCTTCTCCCGAGTGGAAGCCATT
TAAATTGGAAAGATTAAATAAATGAAATTCTCAAATGATAATAAAAAATTTTTTTAATTG
TATGAAACCTACCATCCATAATACTATATTAAATGTATATAATAACTATAAAAATTTCCT
TTAATTGATATAAATAAATCTTTGATTCAAAAAAGTTTACAATTTAATAAATCTTAAATA
CTAAACGAGTTTTTATTCAATATATATTTTCTGTAGCAAATGGTAGACATAAAATTACTA
AAACAAATACTTTAAGCAATACACGATAAGTTTAATAGCGTATTTTAAAAGGTTTTGAAA
AAAGATATATCAGATGCTCAAGAGCAGACTGTATTAGCTAGTATAGTGTTGATATTACAA
TAAACATAGACATTTGAAATTATTTCTATAGCAAATGGTACAAAATCTATTGGTAAGAAA
AATATGTCAGAGCTAGGCAATTTAGTTAATGACTCCCATGCTGAAATTCTAGCAAGAAGA
GCTTTTAAAAAATTTCTCTATGATAATCTAAATAATCCTAAATACTTTTAAATTAATGAT
AATAATAAATATGTTTAAAAGTTTAAAGTTTTATTTTATACGAGCTAAACTCCTTGCGGA
TAGGCTTCAATATTTCAAAATTTAAATGGCAACATACTACCAAGTGTTTCTAATTGTATC
TAGGATTAAGTAATTAATAGTTCAAATAATGAAACCTAAACTCCTGAGCAGAAATAAAAA
TTCTTTTAAAACACAGGAGCTAAATACTACAGCTTCTTGTACGATGAAAAATATCAAGTA
GAAAAAGATTAACAAAATAATATACTTAGAATAAAACCAGGAAGAAGTGATTTACCTTAA
GATTCAAGAAGTTAAAGCTTGAGTTGTAGTGATAAGATAATGATATGGAATGTTATTGGT
TTACAAGGAAGTTTACTTTCTGAGCTATTAGACAGACCAATCTATATTGATTACTTTTTT
ATTGAAAGTGATGGTAATGACTTGAAGGAATTTAAGCAAAAAGTAAGACAAGGTATTAAT
CTTGAAACTAGATTAAACGAGTAGTTTACAAATAAACGTCTAAAAGAAAATGTTTTGAAA
TGGAGAAAAAAACCTATTAGCAAGAATTACTTCTTTAAAAATCCTCCAATAATTGTAACA
AAAAAATATTTTTTTAAGCTTAATAGAAATCTTAGCTAAAATAAGCCAAAATATTTGGAT
TAGCATATAGTCTATTTAAGCGAATATATTGATAATAATGGTGAAAAGAAAGTAGAATTT
ACTGAAATTTTAAATGGTAGCAGTGGCTTAAAATGGGGAATGGGTGAAAAAGGATCACAA
ATCCCAAAAAATTACCCTGCACTATGTAAATATAACTTGTATAAAGCATATTGCCAAATA
AAACATATGAGTAGTAAGAAAAGCTATTTAGTAAACAAAGAATAATCTATTAAATATAAT
CTAATTAAAAGGTAACTGCTAAAGTTGTTTAAGGAAAATATAGTCGATAAAAAAAGATAC
GATAATTTTTGTATTGCTGAATAATAATGA


>TTHERM_00389830(protein)
MHYIEQLNLLNPIIKECLSSKQKNGKIIKIKWKQKVPLYKIPKNNKKSYIEELFSRVEAI
QIGKIKQMKFSNDNKKFFQLYETYHPQYYIKCIQQLQKFPLIDINKSLIQKSLQFNKSQI
LNEFLFNIYFLQQMVDIKLLKQILQAIHDKFNSVFQKVLKKDISDAQEQTVLASIVLILQ
QTQTFEIISIANGTKSIGKKNMSELGNLVNDSHAEILARRAFKKFLYDNLNNPKYFQIND
NNKYVQKFKVLFYTSQTPCGQASIFQNLNGNILPSVSNCIQDQVINSSNNETQTPEQKQK
FFQNTGAKYYSFLYDEKYQVEKDQQNNILRIKPGRSDLPQDSRSQSLSCSDKIMIWNVIG
LQGSLLSELLDRPIYIDYFFIESDGNDLKEFKQKVRQGINLETRLNEQFTNKRLKENVLK
WRKKPISKNYFFKNPPIIVTKKYFFKLNRNLSQNKPKYLDQHIVYLSEYIDNNGEKKVEF
TEILNGSSGLKWGMGEKGSQIPKNYPALCKYNLYKAYCQIKHMSSKKSYLVNKEQSIKYN
LIKRQLLKLFKENIVDKKRYDNFCIAEQQ


>TTHERM_00389830(gene)
ATGCATTACATAGAGTAATTAAATCTACTGAATCCCATAATTAAAGAGTGCTTGAGCAGT
AAGCAAAAGAATGGCAAGATAATTAAGATAAAATGGAAATAGAAAGTGCCTCTATACAAA
ATACCTAAAAACAATAAAAAAAGCTACATAGAGGAGCTCTTCTCCCGAGTGGAAGCCATT
TAAATTGGAAAGATTAAATAAATGAAATTCTCAAATGATAATAAAAAATTTTTTTAATTG
TATGAAACCTACCATCCATAATACTATATTAAATGTATATAATAACTATAAAAATTTCCT
TTAATTGATATAAATAAATCTTTGATTCAAAAAAGTTTACAATTTAATAAATCTTAAATA
CTAAACGAGTTTTTATTCAATATATATTTTCTGTAGCAAATGGTAGACATAAAATTACTA
AAACAAATACTTTAAGCAATACACGATAAGTTTAATAGCGTATTTTAAAAGGTTTTGAAA
AAAGATATATCAGATGCTCAAGAGCAGACTGTATTAGCTAGTATAGTGTTGATATTACAA
TAAACATAGACATTTGAAATTATTTCTATAGCAAATGGTACAAAATCTATTGGTAAGAAA
AATATGTCAGAGCTAGGCAATTTAGTTAATGACTCCCATGCTGAAATTCTAGCAAGAAGA
GCTTTTAAAAAATTTCTCTATGATAATCTAAATAATCCTAAATACTTTTAAATTAATGAT
AATAATAAATATGTTTAAAAGTTTAAAGTTTTATTTTATACGAGCTAAACTCCTTGCGGA
TAGGCTTCAATATTTCAAAATTTAAATGGCAACATACTACCAAGTGTTTCTAATTGTATC
TAGGATTAAGTAATTAATAGTTCAAATAATGAAACCTAAACTCCTGAGCAGAAATAAAAA
TTCTTTTAAAACACAGGAGCTAAATACTACAGCTTCTTGTACGATGAAAAATATCAAGTA
GAAAAAGATTAACAAAATAATATACTTAGAATAAAACCAGGAAGAAGTGATTTACCTTAA
GATTCAAGAAGTTAAAGCTTGAGTTGTAGTGATAAGATAATGATATGGAATGTTATTGGT
TTACAAGGAAGTTTACTTTCTGAGCTATTAGACAGACCAATCTATATTGATTACTTTTTT
ATTGAAAGTGATGGTAATGACTTGAAGGAATTTAAGCAAAAAGTAAGACAAGGTATTAAT
CTTGAAACTAGATTAAACGAGTAGTTTACAAATAAACGTCTAAAAGAAAATGTTTTGAAA
TGGAGAAAAAAACCTATTAGCAAGAATTACTTCTTTAAAAATCCTCCAATAATTGTAACA
AAAAAATATTTTTTTAAGCTTAATAGAAATCTTAGCTAAAATAAGCCAAAATATTTGGAT
TAGCATATAGTCTATTTAAGCGAATATATTGATAATAATGGTGAAAAGAAAGTAGAATTT
ACTGAAATTTTAAATGGTAGCAGTGGCTTAAAATGGGGAATGGGTGAAAAAGGATCACAA
ATCCCAAAAAATTACCCTGCACTATGTAAATATAACTTGTATAAAGCATATTGCCAAATA
AAACATATGAGTAGTAAGAAAAGCTATTTAGTAAACAAAGAATAATCTATTAAATATAAT
CTAATTAAAAGGTAACTGCTAAAGTTGTTTAAGGAAAATATAGTCGATAAAAAAAGATAC
GATAATTTTTGTATTGCTGAATAATAATGA