Identifiers and Description

Gene Model Identifier

TTHERM_00594350

Standard Name

SerL

Aliases

PreTt25089 | 82.m00179 | 3835.m00582

Description

SerL surface antigen; major variable cell surface protein; expressed <20 degrees

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 90.7%

TetraMine Data

TTHERM_00594350

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14984.12.000470901975128e-28hypothetical protein (348 aa)
OxytrichaContig17074.0.g500.000005998506718272351Multidrug resistance efflux tr
ansporter
Stentor CoeruleusSteCoe_43390.00000614421235332821

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:11095959: Doerder FP, Gerber CA (2000) Molecular characterization of the SerL paralogs of Tetrahymena thermophila. Biochemical and biophysical research communications 278(3):621-6

Sequences

>TTHERM_00594350(coding)
ATGAAAGCAACTTCTTTGATACTTATTTCATTAGCTGTAATTGCTACAGTAAACGCTTGT
ACTGATACTAACGCTACTGCTGGTGCTGGAGGTACTTGTTTCTGTAATGCTGGTTATTAT
GGTACTTCTACCGATGTCACTCCTTCTGGATCTTGCACAAAATGCCCAACTGGAACTAAT
TCTGCTGCTGCCACTGCCTCAGGTACTCTTGTCAGCTCATGCACTTGTAATGACACTAAT
GCCTCCCTTAAGGGTGATAACTCTGGTTGCTAATGTAAGGCTAACTTCTACGGTACACCT
AACGCCGTCTCTGGTGGTGCTACTGGATGTTCTGCATGCCCAACTGGTACTACTTCCCCT
GCTGGTACAGCTGCTGTTACTTCATGCGCTTGCAATGATACTAATGCCTCCCTTAAGGGT
GATAACTCTGGTTGCTAATGTAAGGCTAACTTCTACGGTACACCTAACGCCGTCTCTGGT
GGTGCTACTGGATGTACTGCATGCCCAACTGGTTCTGCCGCTGCTGCTGGTTCAACTGCT
GTTACTTCATGCGCTTGTAACGATACTAACTCTTCCCTCAAGGCTGATAACAGTGCTTGT
GTATGTAAGGCTAACTTCTACGGTACACCTAACGCCGTCGCTGGTGGTGCTACTGGATGT
ACTGCATGCCCAACTGGAACAACTTCTACTGCCGGTACAACTGTTATTGGTTCATGCGCT
TGTCCAGACACTAACGCTTCTCTTAACACTGCTACTCCTCCTGTTTGCTAATGTAATGCT
AATTTCTATGGTACCCCTACCTCTTCTGGTGCCAGTGGATGTACTGCATGTCCTTCTGGA
TAAACTGCCCCAGCTGGTTCTGCTACTAATGTTTGCAAAGCTGCTTCAACATCTTCCACT
TACATTTTACCCATAGTTTCTTTGCTTTTCTCTTTAGTTATGCTTATTTGA


>TTHERM_00594350(protein)
MKATSLILISLAVIATVNACTDTNATAGAGGTCFCNAGYYGTSTDVTPSGSCTKCPTGTN
SAAATASGTLVSSCTCNDTNASLKGDNSGCQCKANFYGTPNAVSGGATGCSACPTGTTSP
AGTAAVTSCACNDTNASLKGDNSGCQCKANFYGTPNAVSGGATGCTACPTGSAAAAGSTA
VTSCACNDTNSSLKADNSACVCKANFYGTPNAVAGGATGCTACPTGTTSTAGTTVIGSCA
CPDTNASLNTATPPVCQCNANFYGTPTSSGASGCTACPSGQTAPAGSATNVCKAASTSST
YILPIVSLLFSLVMLI


>TTHERM_00594350(gene)
ATGAAAGCAACTTCTTTGATACTTATTTCATTAGCTGTAATTGCTACAGTAAACGCTTGT
ACTGATACTAACGCTACTGCTGGTGCTGGAGGTACTTGTTTCTGTAATGCTGGTTATTAT
GGTACTTCTACCGATGTCACTCCTTCTGGATCTTGCACAAAATGCCCAACTGGAACTAAT
TCTGCTGCTGCCACTGCCTCAGGTACTCTTGTCAGCTCATGCACTTGTAATGACACTAAT
GCCTCCCTTAAGGGTGATAACTCTGGTTGCTAATGTAAGGCTAACTTCTACGGTACACCT
AACGCCGTCTCTGGTGGTGCTACTGGATGTTCTGCATGCCCAACTGGTACTACTTCCCCT
GCTGGTACAGCTGCTGTTACTTCATGCGCTTGCAATGATACTAATGCCTCCCTTAAGGGT
GATAACTCTGGTTGCTAATGTAAGGCTAACTTCTACGGTACACCTAACGCCGTCTCTGGT
GGTGCTACTGGATGTACTGCATGCCCAACTGGTTCTGCCGCTGCTGCTGGTTCAACTGCT
GTTACTTCATGCGCTTGTAACGATACTAACTCTTCCCTCAAGGCTGATAACAGTGCTTGT
GTATGTAAGGCTAACTTCTACGGTACACCTAACGCCGTCGCTGGTGGTGCTACTGGATGT
ACTGCATGCCCAACTGGAACAACTTCTACTGCCGGTACAACTGTTATTGGTTCATGCGCT
TGTCCAGACACTAACGCTTCTCTTAACACTGCTACTCCTCCTGTTTGCTAATGTAATGCT
AATTTCTATGGTACCCCTACCTCTTCTGGTGCCAGTGGATGTACTGCATGTCCTTCTGGA
TAAACTGCCCCAGCTGGTTCTGCTACTAATGTTTGCAAAGCTGCTTCAACATCTTCCACT
TACATTTTACCCATAGTTTCTTTGCTTTTCTCTTTAGTTATGCTTATTTGA