Identifiers and Description

Gene Model Identifier

TTHERM_00606960

Standard Name

SerH

Aliases

PreTt27352 | 84.m00113 | SerH

Description

SerH surface antigen; glycosyl phosphatidyl inositol (GPI)-linked cell surface antigen (known as the immobilization antigen, i-ag) of unknown function; expression regulated by temperature-sensitive mRNA stability

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF05488 ) PAAR motif
  • ( PF06873 ) Cell surface immobilisation antigen SerH

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 78.2%

TetraMine Data

TTHERM_00606960

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08586.17.996041293534585e-17hypothetical protein (514 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16308338: Katz LA, Snoeyenbos-West O, Doerder FP (2006) Patterns of protein evolution in Tetrahymena thermophila: implications for estimates of effective population size. Molecular biology and evolution 23(3):608-14
  2. Ref:11973302: Gerber CA, Lopez AB, Shook SJ, Doerder FP (2002) Polymorphism and selection at the SerH immobilization antigen locus in natural populations of Tetrahymena thermophila. Genetics 160(4):1469-79
  3. Ref:11080598: Doerder FP (2000) Sequence and expression of the SerJ immobilization antigen gene of Tetrahymena thermophila regulated by dominant epistasis. Gene 257(2):319-26
  4. Ref:10704239: Larsen LK, Andreasen PH, Dreisig H, Palm L, Nielsen H, Engberg J, Kristiansen K (1999) Cloning and characterization of the gene encoding the highly expressed ribosomal protein l3 of the ciliated protozoan Tetrahymena thermophila. Evidence for differential codon usage in highly expressed genes. Cell biology international 23(8):551-60
  5. Ref:9539428: Deak JC, Doerder FP (1998) High frequency intragenic recombination during macronuclear development in Tetrahymena thermophila restores the wild-type SerH1 gene. Genetics 148(3):1109-15
  6. Ref:7590308: Deak JC, Doerder FP (1995) Sequence, codon usage and cysteine periodicity of the SerH1 gene and in the encoded surface protein of Tetrahymena thermophila. Gene 164(1):163-6
  7. Ref:7731807: McMillan PJ, Stanley JS, Bannon GA (1995) Evidence for the requirement of protein synthesis and protein kinase activity in the temperature regulated stability of a Tetrahymena surface protein mRNA. Nucleic acids research 23(6):942-8
  8. Ref:7828814: LaCrosse GL, Doerder FP (1994) A temperature-sensitive mutation of the temperature-regulated SerH3 i-antigen gene of Tetrahymena thermophila: implications for regulation of mutual exclusion. Genetics 138(2):297-301
  9. Ref:1453361: Ko YG, Thompson GA (1993) Immobilization antigens from Tetrahymena thermophila are glycosyl-phosphatidylinositol-linked proteins. The Journal of protozoology 39(6):719-23
  10. Ref:8414992: McMillan PJ, Tondravi MM, Bannon GA (1993) rseB, a chromosomal locus that affects the stability of a temperature-specific surface protein mRNA in Tetrahymena thermophila. Nucleic acids research 21(18):4356-62
  11. Ref:1522546: Smith DL, Doerder FP (1992) Exceptions to mutual exclusion among cell surface i-antigens of Tetrahymena thermophila during salt stress and stationary phase. The Journal of protozoology 39(5):628-35
  12. Ref:1732170: Smith DL, Doerder FP (1992) Multiple effects of mutation on expression of alternative cell surface protein genes in Tetrahymena thermophila. Genetics 130(1):97-104
  13. Ref:1403985: Ron A, Williams NE, Doerder FP (1992) The immobilization antigens of Tetrahymena thermophila are glycoproteins. The Journal of protozoology 39(4):508-10
  14. Ref:2233735: Tondravi MM, Willis RL, Love HD, Bannon GA (1990) Molecular characterization of SerH3, a Tetrahymena thermophila gene encoding a temperature-regulated surface antigen. Molecular and cellular biology 10(11):6091-6
  15. Ref:2621229: Bolivar I, Guiard-Maffia J (1989) Cellular localization of the SerH surface antigen in Tetrahymena thermophila. Journal of cell science 94 ( Pt 2)( ):343-54
  16. Ref:2471832: Doerder FP, Hallberg RL (1989) Identification of a cDNA coding for the SerH3 surface protein of Tetrahymena thermophila. The Journal of protozoology 36(3):304-7
  17. Ref:3336362: Love HD, Allen-Nash A, Zhao QA, Bannon GA (1988) mRNA stability plays a major role in regulating the temperature-specific expression of a Tetrahymena thermophila surface protein. Molecular and cellular biology 8(1):427-32
  18. Ref:3211135: Kile JP, Love HD, Hubach CA, Bannon GA (1988) Reproducible and variable rearrangements of a Tetrahymena thermophila surface protein gene family occur during macronuclear development. Molecular and cellular biology 8(11):5043-6
  19. Ref:2854007: Tondravi MM (1988) DNA rearrangements associated with the H3 surface antigen gene of Tetrahymena thermophila that occur during macronuclear development. Current genetics 14(6):617-26
  20. Ref:3666439: Doerder FP, Berkowitz MS (1987) Nucleo-cytoplasmic interaction during macronuclear differentiation in ciliate protists: genetic basis for cytoplasmic control of SerH expression during macronuclear development in Tetrahymena thermophila. Genetics 117(1):13-23
  21. Ref:3735149: Doerder FP, Berkowitz MS (1986) Purification and partial characterization of the H immobilization antigens of Tetrahymena thermophila. The Journal of protozoology 33(2):204-8
  22. Ref:3537733: Bannon GA, Perkins-Dameron R, Allen-Nash A (1986) Structure and expression of two temperature-specific surface proteins in the ciliated protozoan Tetrahymena thermophila. Molecular and cellular biology 6(9):3240-5
  23. Ref:3915784: Williams NE, Doerder FP, Ron A (1985) Expression of a cell surface immobilization antigen during serotype transformation in Tetrahymena thermophila. Molecular and cellular biology 5(8):1925-32
  24. Ref:4054606: Doerder FP, Berkowitz MS, Skalican-Crowe J (1985) Isolation and genetic analysis of mutations at the SerH immobilization antigen locus of Tetrahymena thermophila. Genetics 111(2):273-86

Sequences

>TTHERM_00606960(coding)
ATGTAAAACAAAACTATAATAATTTGCTTAATAATTTCTTAACTTCTGGTTTCTGTATTT
TCATCAGCAGGAGGTCAAGCTAATTGTACAGGTGTTGCTGCTGGTACCGATTGTGCTAGT
GTCTGTGGAGTACCTACAGTTGCAGGAACTGGTACAACAGCTTGTAGTTGGGTTAGTTCT
TCTACTTTGACCACTTGCACTGTTACTGATTGTACTTGCCTAACTACTGGTACTGTAACT
GGTATCACTAATTTAAATGATTAATTTTGTACTTCTTGTAAAGGATCTACCTCAAATACC
TATGCTAATGGTGCTGGAACTGCTTGTGTAGCTGCTTCTGCTTCATGCAACAGCACCATA
AGAGGAACTACTGCATGGACTGTTGGTGATTGCACCGTTTGTACTCCTACTACCCCTGCA
TTGGTTGGTAGTACTTGTAAGGCTTGTAATACTATAAGTAGTGCATGGACTGATGCAAAT
TGTGCTGCATGCGCCAGTACTTCTACCCCTAAAGGTAACACAAATTTTGCTAACTCTGCT
GGTACTGCTTGTGTTAATGCTTCCGCAACATGTGCTAGTGGTAGTAGAGGTACTACTGCT
GCCAATGCTTGGACAGCTGCTGATTGTCTTGCTTGTACACCTGCTACTCCTGCCGTACAA
TTTGGTGCTTCTCCTGCTACTACTTCTAGTTGTGTTGCTTGTAATACTATTAATTCAGGA
TGGACAGATGCTAACTGTAATTCATGTGCTATGGCTGCTAGCCCTTAAACAAAAAATATC
GTCGCTAAGGCTGATGGAAGTGCTTGTGTAGCAGCTGTGTTTTCATGCACTCAATCTGCT
AGAGGTTCAAATAAATGGACTAATGCAGACTGTGCCGCCTGCAATGGTACTGCTGCTAAT
GCAAATCAATATGCCTCTGCTGATGGTTCTACATGTCAAGCTACATAGGCTTCTAGTACT
TTCAGTGGTTAGATCTTTGTTAGCATTTTATTAGTTTTATCTGCTTTGTTAATTTGA


>TTHERM_00606960(protein)
MQNKTIIICLIISQLLVSVFSSAGGQANCTGVAAGTDCASVCGVPTVAGTGTTACSWVSS
STLTTCTVTDCTCLTTGTVTGITNLNDQFCTSCKGSTSNTYANGAGTACVAASASCNSTI
RGTTAWTVGDCTVCTPTTPALVGSTCKACNTISSAWTDANCAACASTSTPKGNTNFANSA
GTACVNASATCASGSRGTTAANAWTAADCLACTPATPAVQFGASPATTSSCVACNTINSG
WTDANCNSCAMAASPQTKNIVAKADGSACVAAVFSCTQSARGSNKWTNADCAACNGTAAN
ANQYASADGSTCQATQASSTFSGQIFVSILLVLSALLI


>TTHERM_00606960(gene)
ATGTAAAACAAAACTATAATAATTTGCTTAATAATTTCTTAACTTCTGGTTTCTGTATTT
TCATCAGCAGGAGGTCAAGCTAATTGTACAGGTGTTGCTGCTGGTACCGATTGTGCTAGT
GTCTGTGGAGTACCTACAGTTGCAGGAACTGGTACAACAGCTTGTAGTTGGGTTAGTTCT
TCTACTTTGACCACTTGCACTGTTACTGATTGTACTTGCCTAACTACTGGTACTGTAACT
GGTATCACTAATTTAAATGATTAATTTTGTACTTCTTGTAAAGGATCTACCTCAAATACC
TATGCTAATGGTGCTGGAACTGCTTGTGTAGCTGCTTCTGCTTCATGCAACAGCACCATA
AGAGGAACTACTGCATGGACTGTTGGTGATTGCACCGTTTGTACTCCTACTACCCCTGCA
TTGGTTGGTAGTACTTGTAAGGCTTGTAATACTATAAGTAGTGCATGGACTGATGCAAAT
TGTGCTGCATGCGCCAGTACTTCTACCCCTAAAGGTAACACAAATTTTGCTAACTCTGCT
GGTACTGCTTGTGTTAATGCTTCCGCAACATGTGCTAGTGGTAGTAGAGGTACTACTGCT
GCCAATGCTTGGACAGTTGCTGATTGTCTTGCTTGTACTCCTGCTACTCCTGTTTTCGTA
CCCGCTGCTTCCCCTGCAGTAACTACTTCTTGTGTTGCTTGCTCTGCTGCCACTTCAGGT
TTGAATGATGCCTTATGTAATGCTTGTGCATCAAGTGCTTCCCCTGCAGCTAAAACTACT
TTTGCTAATACTGCTGGTTCTGCTTGTGTTGCTTCTTCCGCAACATGCACTGCTGGTAGT
AGAGGTACTACTGCTGCCAATGCTTGGACAGCTGCTGATTGTCTTGCTTGTACACCTGCT
ACTCCTGCCGTACAATTTGGTGCTTCTCCTGCTACTACTTCTAGTTGTGTTGCTTGTAAT
ACTATTAATTCAGGATGGACAGATGCTAACTGTAATTCATGTGCTATGGCTGCTAGCCCT
TAAACAAAAAATATCGTCGCTAAGGCTGATGGAAGTGCTTGTGTAGCAGCTGTGTTTTCA
TGCACTCAATCTGCTAGAGGTTCAAATAAATGGACTAATGCAGACTGTGCCGCCTGCAAT
GGTACTGCTGCTAATGCAAATCAATATGCCTCTGCTGATGGTTCTACATGTCAAGCTACA
TAGGCTTCTAGTACTTTCAGTGGTTAGATCTTTGTTAGCATTTTATTAGTTTTATCTGCT
TTGTTAATTTGA