Identifiers and Description

Gene Model Identifier

TTHERM_01546860

Standard Name

SWR1

Aliases

PreTt02601 | 458.m00006

Description

Member of the SWR complex. SNF2 family N-terminal domain containing protein.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF07529 ) HSA
  • ( PF02524 ) KID repeat
  • ( PF05565 ) Siphovirus Gp157
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( PF04702 ) Vicilin N terminal region
  • ( PF08657 ) DASH complex subunit Spc34
  • ( PF00176 ) SNF2 family N-terminal domain
  • ( PF02671 ) Paired amphipathic helix repeat
  • ( TIGR00019 ) peptide chain release factor 1
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF04851 ) type III restriction enzyme, res
  • ( TIGR00133 ) glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_01546860

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_237270
Tetrahymena borealisEI9_10524.19.997093137033517e-262SNF2 family domain-containing
protein (1860 aa)
SGDYDR334W9.997093137033517e-262SWR1 Swi2/Snf2-related ATPase
that is the structural compone
nt of the SWR1 complex, which
exchanges histone variant H2AZ
(Htz1p) for chromatin-bound h
istone H2A
OxytrichaContig826.1.g1301.000444791949842e-158SNF2 family N-terminal domain
WormBaseWBGene000070273.999453553586398e-137locus:ssl-1 Helicase ssl-1
status:Partially_confirmed
UniProt:Q9NEL2 protein_id:CB
W48563.1
DictyBaseDDB_G02676382.000319284850678e-127DDB_G0267638 on chromosome: 1
position 464992 to 474506

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29523178: Saettone A, Garg J, Lambert JP, Nabeel-Shah S, Ponce M, Burtch A, Thuppu Mudalige C, Gingras AC, Pearlman RE, Fillingham J (2018) The bromodomain-containing protein Ibd1 links multiple chromatin-related protein complexes to highly expressed genes in Tetrahymena thermophila. Epigenetics & chromatin 11(1):10

Sequences

>TTHERM_01546860(coding)
ATGAGTTCGGAGTAGGATAAAAACCAAACAAGTAGCAAGGACTCTAATGAAAATTAAAAT
GAGACTTAGCAAGAAGGTAAAAAGGCAGTAAATAAAAAAGGAAGCTAAAAAAAAGATAAA
AATGGATCTTCGGCAAGTGCACAATAAGATAAAGCTAGCAAAGAGAATGAAAATGAAGAT
CTAGATATGATAAATGAAAATTCTGATAATTAGCAAGACAATATAGATTAGCATGAAAAA
GATGAAGATAATAGAAACTAATCAGGTGAAAACAATTCTTTTTTCAAGTAATCGCAAGAG
GAAACTGAAAATTAGAATAACTAAAACGAAAGCAATTTATAGCGTAGATTATCTTCAAGA
AAGCGTAAAGAAAAACATATTGACGATATGGATTTTGGATATAGAAAGGCAGTAACTCCT
GTTAAAAAAATTAAGAAAAGCAAGTCAGCAGACCCCAAAGCTAAGAAGGAATAGCCTTAA
AAGAAGAAAGCTCCCTAGGTTCAAAAGTAATAGCAAGCTTAATCTGCTTAGCAGTAGGAT
ACTTCTATAAATTAATAATAAAACTAGCAAAGTGCACAGAAATAATAAAAAACACCTATC
AAGCAAGATAAAAAAGGTAAAGAAGTGAAAAGGGAAAATAAAACTCCTATAAAAAATGAA
AAAGCTGAAAAGACTTCGAGTGAAGGTAAAGGATAAGAATAAAAAAGCGAATCATCAGTT
AAGAGAGATAACAATAAAAGGCCAAATCTTTTTAAAAAGACAAATAGCAGTGCTTTGGCA
GCTGCTAAAAGCAATGAGAAAAAGCCAACTTAATAAAATTAAAGCTCAATATTGAATTAT
ATGAATAATTCTGCTTCGAAAAAATAGAAAGACAATTTAAGTATAGCATCAGATCTTACA
GCTTCAACTGAAAAGGAAACAAAGAATTCAAAGAACACTGTAAGCAAAATCAAAGAATAA
ATGAAAGAAAAAGCAGAAAAGGAATAGTTAGAGCAAAGATCAGAAAATAAAAAGCATGAT
AAGATAAAGCAAAAGGAAATCATCAAACAAGAAAAGCTGTAAAAAAAGTTAGAAATGAAA
ATAGAAAAGGAAGAGAGAGATAAAAAGAAAGCCTAAGAAAAGCTAGAAAAAGAGTAGCAG
TAATTAGAAGAGCAAATGTATAAAAAAGAAAAGAAAGAAAAATTGAAAAAAAATCCTAAT
AAAAGAATATTTAATCCTTAAGAATACAATGAAAATCTTAAAAAAAAGATTCAATTAGAA
GGTTAATTACAAGAACTCTATGATTAATATGGTAGAAAATTAGAAAAAGTACATGAACCT
AAGTAAAACTAGACACATTGGGATTATATATTACAAGAAATACATGAAACTGCAGAATAT
TTTTAGAAGAGGAGAAGTTACTTTAAATTTTAAACTAGAAAAATAGCTAAACACTCAGTC
ACTGCATTATCGAATCTTAGATAGTCTAAGGAACAAAAAATAAAAGAAGAAGCAAAGAGA
ATTAAAAAAATAGCTGAATCCTGCAATCAAATGGTTTAAAGATATTTCTGGAGAAGCATG
CATAAAGTGAAAAAATTCATGAAAGTTATTGAATACTAAAAGGAGTAAAAAGAAGATTAA
CAAAAACGTTTAGAAAATTTAGTTTCTGAATAATGGTAATTATCTATGAAGCTAGCCAAG
TTACTTTAATTAACTAAGGACATTCCTGAATTGGATACTTAAAAAGCAGTAGAAGAATCT
AAGGCCAAATCAAATTAAAGAGATCTTGAAGAAAAGTAGAAATAAGAAGCAAAAGAAGAG
GAGTAGGCTAAATAAGAGGAAGAAGAAATTCAGGATTAGTAGGAAAATAAATTAAGTGCT
GAAGAAGAAGAAAAATTGAAATAAGAATAAGAATAACAAGAATAATTAGCCAAAAAATTA
TAGGAAATTAAGAGAGAGTAAGAGGAGATAGAGAAGGAGCTTAAAAGAATTGAGGAATTA
GAAAATGAATTGCTCTCAAATGAAGAGTTGGCAAAAGAATATAATATCAATATTTAATTG
AAAAGAGATGGACTTAATAATTATACTTTTGACAAGATGCTCTACTCTAAGATCAATCCT
TCTCCAGTTCAATCTGCTAACGATCTTGCTCCTCAGCTTTAAGAAATCGAAGAGGAAGAA
GAGGAAGAAGAATTAGACAAATATGGAAATATAAAACTTCCTTTCCATGATTTTGAACCA
TAAGCTATTACTTTGAATGATGCTACAATCGTTTAGCCCTTTTTACTGAAAGGTAGACTA
AGAGAATATTAATTAATTGGTTAAAACTGGCTTGCTACATTATAATAGAAGAAAATGAAC
GGTATTTTGGCTGATGAAATGGGTCTCGGTAAGACAATTTAGACTATATCTCTTTTGGCA
CATCTTGCTTGCAACAAAGGCATCTGGGGGCCACATTTAATTATTGTACCAACAAGTATT
CTCATTAACTGGGAAATCGAATTTAAAAAGTGGTGTCCTGCATTTAAAATTATGACTTAT
TATGGATCCCCAAAAGAAAGAAAATTAAAAAGAGCAGGTTGGAGCAAAATGAACCACTTC
TAAGTCTGTATTACTTCTTATAAAATTGCATTACAAGATCAAAAAATTTTCAGAAGAAAA
AAATGGTATTTCATGGTCTTAGATGAAGCTCAGCACATTAAAAACTTTAAGTCTCAAAGA
TGGCAAGTATTGTTAAACTTTCACACAAAGCATCGTCTCCTCTTAACTGGTACACCATTA
TAAAATGATGTTGGTGAACTCTGGTCTTTGTTGCATTTCCTTATGCCTAGAATATTCGAC
TCTCACTCTGATTTTATGGAATGGTTCTCTATTCCTATGCAGCAAGCGCTTTAGAAAAAT
TTACCTATTAGTCAAGAAATATTGAAAAAATTGCATTCTATTCTGAGACCCTTTTTGTTG
AGAAGATTGAAGAAAGATGTGGAAAAATAACTTCCCACAAAGACTGAATATATAATAAAA
TGTCCTCTTTCGAGAAGGTAGAGATATCTTTATGATGAATTTATCAGTAGAGACGATACT
AAGAATTCAATGAAGTAGTAAGACTTTTTGGGTTTGATGAATATTGTTATGTAACTAAAA
AAAGTTTGTAATCACCCTGACTTGTTTGAAGCAAGAACTATTGAAAGTCCTTTTTCTTCA
ATGAAGCTAAAGCTAGTTGTTCTCTCTCACTTTTTGTATAGCACAAAGAGCAGAATCCCA
TTTAAATTAGATTTTATAAATAATGAACTCAATAAAACTGCTTATAATATTTAAAGGGCA
AAGAGTCTGATGCCAATAGCAGATGATTTCTATGAAATGAACAATGTTCTCTTTTCAGAG
GAGAACTGGCCTTCTTACATACCTTATTATGCTCAAAGATGGAGAATTTTAAAACAATTT
ACTAAACAGCAATCATTAAAAAGACTCTACAAATCTAACAGAGCTAGAATTCAGAGTGAT
CATGTTGTTTACGGCATAGATACCATCGATTTCCTAACTGTTAAACAAGCTAGAGATCCT
TATATTGAAATGAGTGAATTTAAAACACTCACATTCGAATAAGCTCTTGATTCTGTAAGA
GTTTTAATCAATGAATTTTCTTTTGCTCAGAGAGCTATAGCTGAACCTCCTGAGGTTATC
ATTACTCCCTTTGATTCAGAAAAAAATAATTACTATTAAAGATTTAACAAGACTATGAAA
CAATAATTAAGTGTAGTTGCTAAAGAATTCCACTACTGCCATATAAGAAGAACTCTGTGT
TTCCCTAGTAAAAAATTGCTTATGTATGACTGTGGTAAGTTAAATACTATGATTCAATTG
CTTAAAAAATTAAAATAAAGAGGTGATAAAGTTCTTATTTTTACACAAATGTCAAGAATG
CTTGATATTTTTGAAAATGTGCTCAACTTATTTAACTTCACATATGTCAGATTGGATGGT
TCAACGAAGATTGAAAATAGATAGAAAGTTGTAGAAAGATTTAATGGCGATTCTCGTATT
TTCTGCTTTATTTCTTCTACAAGAAGTGGTGGTATCGGTCTTAACTTGACTGGAGCCAAC
GTTGTCGTTTTCTATGATACAGATTGGAACCCTGCTATGGACAGATAAGCTTAAGACAGA
TGTCATAGAATCGGTTAAACTAGAAACGTCTCTATTTACAGATTGATTTCCGAATACACA
ATAGAAGAAAATATTCTTTTAAAGAGTATTTAAAAGAGAAAATTAGACGAATATATTATG
GAAGAAGGTATGTTCAATACTCAATTTTATGAAAAGTTTGATGTAAGAGGAATTCTTGGA
GGAATGCTTGGACAAGCTTAGAAAAAATAAGAAGACAATATTGATAAATCTTAAATGGAA
AAAATACTTGAAAAAGTAGAAGATAAAGAAGATACTGTGGCTTTGAAAAAAGCTTAAATG
GAAGAAATTGAATATGTCACAGAAGGCGCAGCAGAAGTTGCAGCGATGGATAAAGATGAT
GAAGAGTAAAAAGAAAAACAGTTTTCAGTCGATGTTTAGAAGTTCCCTCCTATATTTTAG
TATGGCTTAAAGTATATTAAGAATGAAGAATAGTTGCATTAAAATGATGGGGAAGACAAG
TTTATGGATGATGATCTATTTGATGATGATCTTGATGAAGAAGATGAAGACGAAGAAGAA
GAAAATGAAGAAGAAAAAATTAAATAAACTCCTATTGAAGAAGACGATGAAGAGTTTGTG
TATGAAAATGAAAATTCTGCTAAGAAAGACGATGATGAAGATGAAGATGAAAATAACAGT
ATACTTCCTTAGAGAAACAACAATCCTTCATTTAAGTAGAGAGGACTCGATGAGGATGAT
GAAGAGGAAGAAGAAGAGGATGAAGATGAAGAAGAAGAAAATGATAAAGTTAAAGAAGAC
GATGATATGGATGAAGAAGATTCTAAATAAGAAGGATATTATGGTGATAGAAATAAAAAT
AAATCACCTTCTTCAAGTCCAACAAATAAATAAGTGAAAAAATAAAGCTTTGAAGAAGAT
GAGGAAGAGGAAGATGAAAGTAACGAAGCTGAGACAGGCAGAGTTAGAAAGAAATCAAAG
GATTCAAATAAAAGCATGGATGAAGAAGATGAAGATAATGAAGAGGAAGAAGAAGAAGTT
GAAATTGAAATAGAAGAAAATGACTCTGACTCTAATAGAAAATAAAATGGTTACAAATAG
TAAGATAAGAACTCTCCTTCTATACAAAAGAGCAGCCAAGAAACTAATAAAAATGAAGGA
GAAGCATTTGATGAGCAAGAAATAGAAGAAGAAATTGAATCTAACAAAAATAGTGTATTA
AAAAGTGGAAAGGATTCTAGTAAAGTAAAGAAGAAAGTAAGATTCTTAGATTAGGTTGAA
GTTGAAGTTGAAAAATAAGCTCCTCCCCCTCCACCTGCTTCTAAATCTAGTAAAAATGAT
GAAGAAGAAGACGATGAAGAGAATGAAAATGAAGATATTGAAGATGATGATGAAGAAGAA
GATGTTGAAGAGGAAGATAAATTTAACGATGAAGATAGAAAAAATTCTCTCAGAATA


>TTHERM_01546860(protein)
MSSEQDKNQTSSKDSNENQNETQQEGKKAVNKKGSQKKDKNGSSASAQQDKASKENENED
LDMINENSDNQQDNIDQHEKDEDNRNQSGENNSFFKQSQEETENQNNQNESNLQRRLSSR
KRKEKHIDDMDFGYRKAVTPVKKIKKSKSADPKAKKEQPQKKKAPQVQKQQQAQSAQQQD
TSINQQQNQQSAQKQQKTPIKQDKKGKEVKRENKTPIKNEKAEKTSSEGKGQEQKSESSV
KRDNNKRPNLFKKTNSSALAAAKSNEKKPTQQNQSSILNYMNNSASKKQKDNLSIASDLT
ASTEKETKNSKNTVSKIKEQMKEKAEKEQLEQRSENKKHDKIKQKEIIKQEKLQKKLEMK
IEKEERDKKKAQEKLEKEQQQLEEQMYKKEKKEKLKKNPNKRIFNPQEYNENLKKKIQLE
GQLQELYDQYGRKLEKVHEPKQNQTHWDYILQEIHETAEYFQKRRSYFKFQTRKIAKHSV
TALSNLRQSKEQKIKEEAKRIKKIAESCNQMVQRYFWRSMHKVKKFMKVIEYQKEQKEDQ
QKRLENLVSEQWQLSMKLAKLLQLTKDIPELDTQKAVEESKAKSNQRDLEEKQKQEAKEE
EQAKQEEEEIQDQQENKLSAEEEEKLKQEQEQQEQLAKKLQEIKREQEEIEKELKRIEEL
ENELLSNEELAKEYNINIQLKRDGLNNYTFDKMLYSKINPSPVQSANDLAPQLQEIEEEE
EEEELDKYGNIKLPFHDFEPQAITLNDATIVQPFLLKGRLREYQLIGQNWLATLQQKKMN
GILADEMGLGKTIQTISLLAHLACNKGIWGPHLIIVPTSILINWEIEFKKWCPAFKIMTY
YGSPKERKLKRAGWSKMNHFQVCITSYKIALQDQKIFRRKKWYFMVLDEAQHIKNFKSQR
WQVLLNFHTKHRLLLTGTPLQNDVGELWSLLHFLMPRIFDSHSDFMEWFSIPMQQALQKN
LPISQEILKKLHSILRPFLLRRLKKDVEKQLPTKTEYIIKCPLSRRQRYLYDEFISRDDT
KNSMKQQDFLGLMNIVMQLKKVCNHPDLFEARTIESPFSSMKLKLVVLSHFLYSTKSRIP
FKLDFINNELNKTAYNIQRAKSLMPIADDFYEMNNVLFSEENWPSYIPYYAQRWRILKQF
TKQQSLKRLYKSNRARIQSDHVVYGIDTIDFLTVKQARDPYIEMSEFKTLTFEQALDSVR
VLINEFSFAQRAIAEPPEVIITPFDSEKNNYYQRFNKTMKQQLSVVAKEFHYCHIRRTLC
FPSKKLLMYDCGKLNTMIQLLKKLKQRGDKVLIFTQMSRMLDIFENVLNLFNFTYVRLDG
STKIENRQKVVERFNGDSRIFCFISSTRSGGIGLNLTGANVVVFYDTDWNPAMDRQAQDR
CHRIGQTRNVSIYRLISEYTIEENILLKSIQKRKLDEYIMEEGMFNTQFYEKFDVRGILG
GMLGQAQKKQEDNIDKSQMEKILEKVEDKEDTVALKKAQMEEIEYVTEGAAEVAAMDKDD
EEQKEKQFSVDVQKFPPIFQYGLKYIKNEEQLHQNDGEDKFMDDDLFDDDLDEEDEDEEE
ENEEEKIKQTPIEEDDEEFVYENENSAKKDDDEDEDENNSILPQRNNNPSFKQRGLDEDD
EEEEEEDEDEEEENDKVKEDDDMDEEDSKQEGYYGDRNKNKSPSSSPTNKQVKKQSFEED
EEEEDESNEAETGRVRKKSKDSNKSMDEEDEDNEEEEEEVEIEIEENDSDSNRKQNGYKQ
QDKNSPSIQKSSQETNKNEGEAFDEQEIEEEIESNKNSVLKSGKDSSKVKKKVRFLDQVE
VEVEKQAPPPPPASKSSKNDEEEDDEENENEDIEDDDEEEDVEEEDKFNDEDRKNSLRI


>TTHERM_01546860(gene)
ATATACTTTTAATTTATTCATTCATTTATTTAATTATAAATTAAATAATTAATTGAGTCA
AGGATTTCTTAATTATGAAAGAAAGTTAATAAAGAATATACATACATACCTACCTTTATT
GTTTTTAAGTTAATATTTTGCATTCATTTTTGTATGACAATTATCAATTTATTTAATAAA
ATAATGCTAATTATTTCATTCATTATTTAAACACAACAAATTAATATATCATTTAGCAGT
TCTTAATTAAATAAAGGCAAATAATATATACAGAGAGAAACAGGAAGAAACAAACAAAGA
AAGAAAGAAACAAATAAACAAACAAACAAATAATCAATCAAACAAACAAACAACAAAGAA
ACGTTTATTTTTTATTTATCAAGCAAGAAAGGAGAAGTCCATTTGATTATCAAAACGAAA
AATATTAAAGCATCATTAAGGATATATAGAAAACAAATTAGACATATCACAATTGCAAAT
AGGTGTAAGTTTTTTAGTGATTAGTTAATATTAAATATCTATCTGCCTATTCAATTACTT
AAATTAGTTTAAAATTGTGAATTCATTTTATTTCTGATATAAAAGGAGAAGCCATGAGTT
CGGAGTAGGATAAAAACCAAACAAGTAGCAAGGACTCTAATGAAAATTAAAATGAGACTT
AGCAAGAAGGTAAAAAGGCAGTAAATAAAAAAGGAAGCTAAAAAAAAGATAAAAATGGAT
CTTCGGCAAGTGCACAATAAGATAAAGCTAGCAAAGAGAATGAAAATGAAGATCTAGATA
TGATAAATGAAAATTCTGATAATTAGCAAGACAATATAGATTAGCATGAAAAAGATGAAG
ATAATAGAAACTAATCAGGTAACAATTTCAAGACAAGCTATATATAGCTTTTTATATTTT
TTTAATAATTTGTGTTTTACAATTTGTAGAATGAATTAATAGAGATATTTATTTTTAATT
TTAGAGCAGGATTATTTATAAAGAATCAATTGAGTATTTGTCTTAATCAGAATTAATATT
AATAGGTGAAAACAATTCTTTTTTCAAGTAATCGCAAGAGGAAACTGAAAATTAGAATAA
CTAAAACGAAAGCAATTTATAGCGTAGATTATCTTCAAGAAAGCGTAAAGAAAAACATAT
TGACGATATGGATTTTGGATATAGAAAGGCAGTAACTCCTGTTAAAAAAATTAAGAAAAG
CAAGTCAGCAGACCCCAAAGCTAAGAAGGAATAGCCTTAAAAGAAGAAAGCTCCCTAGGT
TCAAAAGTAATAGCAAGCTTAATCTGCTTAGCAGTAGGATACTTCTATAAATTAATAATA
AAACTAGCAAAGTGCACAGAAATAATAAAAAACACCTATCAAGCAGTAATAGAATAAATG
CAAAATATCTATTAATATTTAAATATTTTATGTTTAAAAAGAGATAAAAAAGGTAAAGAA
GTGAAAAGGGAAAATAAAACTCCTATAAAAAATGAAAAAGCTGAAAAGACTTCGAGTGAA
GGTAAAGGATAAGAATAAAAAAGCGAATCATCAGTTAAGAGAGATAACAATAAAAGGCCA
AATCTTTTTAAAAAGACAAATAGCAGTGCTTTGGCAGCTGCTAAAAGCAATGAGAAAAAG
CCAACTTAATAAAATTAAAGCTCAATATTGAATTATATGAATAATTCTGCTTCGAAAAAA
TAGAAAGACAATTTAAGTATAGCATCAGATCTTACAGCTTCAACTGAAAAGGAAACAAAG
AATTCAAAGAACACTGTAAGCAAAATCAAAGAATAAATGAAAGAAAAAGCAGAAAAGGAA
TAGTTAGAGCAAAGATCAGAAAATAAAAAGCATGATAAGATAAAGCAAAAGGAAATCATC
AAACAAGAAAAGCTGTAAAAAAAGTTAGAAATGAAAATAGAAAAGGAAGAGAGAGATAAA
AAGAAAGCCTAAGAAAAGCTAGAAAAAGAGTAGCAGTAATTAGAAGAGCAAATGTATAAA
AAAGAAAAGAAAGAAAAATTGAAAAAAAATCCTAATAAAAGAATATTTAATCCTTAAGAA
TACAATGAAAATCTTAAAAAAAAGATTCAATTAGAAGGTTAATTACAAGAACTCTATGAT
TAATATGGTAGAAAATTAGAAAAAGTACATGAACCTAAGTAAAACTAGACACATTGGGAT
TATATATTACAAGAAATAGTAAGATTTATTTATTTATATATCATTAGAATTCCAAATAAA
TATTTTCAAAATTATGACTAGAATACAATTTAATTGTTGTAAAATGTTAGAATAAAATTT
AAAGTTAAGTGAATAGATTAATACCTTTGATAATAAAAAACAATTAATTAATTAATTGAA
TTCATCGTTTAAATAGATTAATTAATTCTAAAAAATTAAAAATAATTATTACATGTGTTG
ATTAATCTTAATTAATTATAAGAATTTATTTAAATAGAAAACAAGAAAAAATAGTAAATT
TTAATTCAAATGAATAACAAAATAATTAAATTAAAATCAATTTTTATTTTTGGGTTATTT
GGCTTTAAGATTTTAACAAATTAATTAATTAAATTCTTAACATATTTTTATTAATAATAG
CATGAAACTGCAGAATATTTTTAGAAGAGGAGAAGTTACTTTAAATTTTAAACTAGAAAA
ATAGCTAAACACTCAGTCACTGCATTATCGAATCTTAGATAGTCTAAGGAACAAAAAATA
AAAGTAGATATTGCATTTTTAACTTAACTGAGAAGAACATTTTTATTAACTTTTTTTATA
GGAAGAAGCAAAGAGAATTAAAAAAATAGCTGAATCCTGCAATCAAATGGTTTAAAGATA
TTTCTGGAGAAGCATGCATAAAGTGAAAAAATTCATGAAAGTTATTGAATACTAAAAGGA
GTAAAAAGAAGATTAACAAAAACGTTTAGAAAATTTAGTTTCTGAATAATGGTAATTATC
TATGAAGCTAGCCAAGTTACTTTAATTAACTAAGGACATTCCTGAATTGGATACTTAAAA
AGCAGTAGAAGAATCTAAGGCCAAATCAAATTAAAGAGGTAAAATTTCAATTAATTGCTT
TTTTTAGGTTAATAAATAAATAAATATTTTGAATTTTTAAGATCTTGAAGAAAAGTAGAA
ATAAGAAGCAAAAGAAGAGGAGTAGGCTAAATAAGAGGAAGAAGAAATTCAGGATTAGTA
GGAAAATAAATTAAGTGCTGAAGAAGAAGAAAAATTGAAATAAGAATAAGAATAACAAGA
ATAATTAGCCAAAAAATTATAGGAAATTAAGAGAGAGTAAGAGGAGATAGAGAAGGAGCT
TAAAAGAATTGAGGAATTAGAAAATGAATTGCTCTCAAATGAAGAGTTGGCAAAAGAATA
TAATATCAATATTTAATTGAAAAGAGATGGACTTAATAATTATACTTTTGACAAGATGCT
CTACTCTAAGATCAATCCTTCTCCAGTTCAATCTGCTAACGATCTTGCTCCTCAGCTTTA
AGAAATCGAAGAGGAAGAAGAGGAAGAAGAATTAGAGTAATCAATTATATCTATAAAACT
AAACTTATTTATTCCATTAAATAAAAAGCAAATATGGAAATATAAAACTTCCTTTCCATG
ATTTTGAACCATAAGCTATTACTTTGAATGATGCTACAATCGTTTAGCCCTTTTTACTGA
AAGGTAGACTAAGAGAATATTAATTAATTGGTTAAAACTGGCTTGCTACATTATAATAGA
AGAAAATGAACGGTATTTTGGCTGATGAAATGGGTCTCGGTAAGACAATTTAGACTATAT
CTCTTTTGGCACATCTTGCTTGCAACAAAGTAATAAATTAAAAATTTATTTTACCTTTTT
AAATAATTTTATTTATTTTTTTTGTTTTTGTTTTTAAGGGCATCTGGGGGCCACATTTAA
TTATTGTACCAACAAGTATTCTCATTAACTGGGAAATCGAATTTAAAAAGTGGTGTCCTG
CATTTAAAATTATGACTTATTATGGATCCCCAAAAGAAAGAAAATTAAAAAGAGCAGGTT
GGAGCAAAATGAACCACTTCTAAGTCTGTATTACTTCTTATAAAATTGCATTACAAGATC
AAAAAATTTTCAGAAGAAAAAAATGGTATTTCATGGTCTTAGATGAAGCTCAGCACATTA
AAAACTTTAAGTCTCAAAGATGGCAAGTATTGTTAAACTTTCACACAAAGCATCGTCTCC
TCTTAACTGGTACACCATTATAAAATGATGTTGGTGAACTCTGGTCTTTGTTGCATTTCC
TTATGCCTAGAATATTCGACTCTCACTCTGATTTTATGGAATGGTAAATTAATTAAATTT
AATTTTGTCTAAACCTATAAGCATAAATAATTCACGCATTAAAATAAAATTAAAATTCTT
GATTTTCTTAGATATTGTGGCAAAAATTTTTAATTTTATAAAATAAAATTATCTAAAAAT
TCTAATCAAAAGTTTGAAGAGTGTTTAGAATTATTATTCAATTGTAAAATTATCAAAAAC
AATTCACAAAAATTAATAAAAAATTATCAAAAACAATAAATCAAATTAATAAAAAATGAT
TTAATATCAATTCAAAAACCTAAATTAAACTGAATAATTTATTTAGATTTTAAAAAATTA
ATTATTTGAAATTTATTTTTTAAACTTAGGTTCTCTATTCCTATGCAGCAAGCGCTTTAG
AAAAATTTACCTATTAGTCAAGAAATATTGAAAAAATTGCATTCTATTCTGAGACCCTTT
TTGTTGAGAAGATTGAAGAAAGATGTGGAAAAATAACTTCCCACAAAGACTGAATATATA
ATAAAATGTCCTCTTTCGAGAAGGTAGAGATATCTTTATGATGAATTTATCAGTAGAGAC
GATACTAAGAATTCAATGAAGTAGTAAGACTTTTTGGGTTTGATGAATATTGTTATGTAA
CTAAAAAAAGTTTGTAATCACCCTGACTTGTTTGAAGCAAGAACTATTGAAAGTCCTTTT
TCTTCAATGAAGCTAAAGCTAGTTGTTCTCTCTCACTTTTTGTATAGCACAAAGAGCAGA
ATCCCATTTAAATTAGATTTTATAAATAATGAACTCAATAAAACTGCTTATAATATTTAA
AGGGCAAAGAGTCTGATGCCAATAGCAGATGATTTCTATGAAATGAACAATGTTCTCTTT
TCAGAGGAGAACTGGCCTTCTTACATACCTTATTATGCTCAAAGATGGAGAATTTTAAAA
CAATTTACTAAACAGCAATCATTAAAAAGACTCTACAAATCTAACAGAGCTAGAATTCAG
AGTGATCATGTTGTTTACGGCATAGATACCATCGATTTCCTAACTGTTAAACAAGCTAGA
GATCCTTATATTGAAATGAGTGAATTTAAAACACTCACATTCGAATAAGCTCTTGATTCT
GTAAGAGTTTTAATCAATGAATTTTCTTTTGCTCAGAGAGCTATAGCTGAACCTCCTGAG
GTTATCATTACTCCCTTTGATTCAGAAAAAAATGTAAGATTTATTTTTTTCTATTTATTT
TCTCTATAATATTAAATAATTCAACAAGACATTTATTTTGCTTAAAGACAATCAAAAATT
TAATAGTTTTTTATGTGTTTATTCAAAGCGAAATATGTTAAAATAAATGCTATCAAACAG
CAAATAAATTTTATAAAATTGATTGAAATTATTTAGAATATTTTTAGGATATGAAATAAT
TCAATTATTTTTTTAAAATTTAGAATTACTATTAAAGATTTAACAAGACTATGAAACAAT
AATTAAGTGTAGTTGCTAAAGAATTCCACTACTGCCATATAAGAAGAACTCTGTGTTTCC
CTAGTAAAAAATTGCTTATGTATGACTGTGGTAAGTTAAATACTATGATTCAATTGCTTA
AAAAATTAAAATAAAGAGGTGATAAAGTTCTTATTTTTACACAAGTAATTAATTAATATT
TTATATTTAATAAAATTAATGTGTTAATAAATCTAATTTTGTTTATTAGATGTCAAGAAT
GCTTGATATTTTTGAAAATGTGCTCAACTTATTTAACTTCACATATGTCAGATTGGATGG
TTCAACGAAGATTGAAAATAGATAGAAAGTTGTAGAAAGATTTAATGGCGATTCTCGTAT
TTTCTGCTTTATTTCTTCTACAAGAAGTGGTGGTATCGGTCTTAACTTGACTGGAGCCAA
CGTTGTCGTTTTCTATGATACAGATTGGAACCCTGCTATGGACAGATAAGCTTAAGACAG
ATGTCATAGAATCGGTTAAACTAGAAACGTCTCTATTTACAGATTGATTTCCGAATACAC
AATAGAAGAAAATATTCTTTTAAAGAGTATTTAAAAGAGAAAATTAGACGAATATATTAT
GGAAGAAGGTATGTTCAATACTCAATTTTATGAAAAGGTAATTTATTTCTTTTTTTAATG
CTTTTAATTGAAAAATTTTATCTAATGATTATAGTTTGATGTAAGAGGAATTCTTGGAGG
AATGCTTGGACAAGCTTAGAAAAAATAAGAAGACAATATTGTAAATTAATTAAAAGAAAA
TATTTTTTTAGCATTTGTAAATGAATGACTTAATTATTATTAGGATAAATCTTAAATGGA
AAAAATACTTGAAAAAGTAGAAGATAAAGAAGATACTGTGGCTTTGAAAAAAGCTTAAAT
GGAAGAAATTGAATATGTCACAGAAGGCGCAGCAGAAGTTGCAGCGATGGATAAAGATGA
TGAAGAGTAAAAAGAAAAACAGTTTTCAGTCGATGTTTAGAAGTTCCCTCCTATATTTTA
GTATGGCTTAAAGTATATTAAGAATGAAGAATAGTTGCATTAAAATGATGGGGAAGACAA
GTTTATGGATGATGATCTATTTGATGATGATCTTGATGAAGAAGATGAAGACGAAGAAGA
AGAAAATGAAGAAGAAAAAATTAAATAAACTCCTATTGAAGAAGACGATGAAGAGTTTGT
GTATGAAAATGAAAATTCTGCTAAGAAAGACGATGATGAAGATGAAGATGAAAATAACAG
TATACTTCCTTAGAGAAACAACAATCCTTCATTTAAGTAGAGAGGACTCGATGAGGATGA
TGAAGAGGAAGAAGAAGAGGATGAAGATGAAGAAGAAGAAAATGATAAAGTTAAAGAAGA
CGATGATATGGATGAAGAAGATTCTAAATAAGAAGGATATTATGGTGATAGAAATAAAAA
TAAATCACCTTCTTCAAGTCCAACAAATAAATAAGTGAAAAAATAAAGCTTTGAAGAAGA
TGAGGAAGAGGAAGATGAAAGTAACGAAGCTGAGACAGGCAGAGTTAGAAAGAAATCAAA
GGATTCAAATAAAAGCATGGATGAAGAAGATGAAGATAATGAAGAGGAAGAAGAAGAAGT
TGAAATTGAAATAGAAGAAAATGACTCTGACTCTAATAGAAAATAAAATGGTTACAAATA
GTAAGATAAGAACTCTCCTTCTATACAAAAGAGCAGCCAAGAAACTAATAAAAATGAAGG
AGAAGCATTTGATGAGCAAGAAATAGAAGAAGAAATTGAATCTAACAAAAATAGTGTATT
AAAAAGTGGAAAGGATTCTAGTAAAGTAAAGAAGAAAGTAAGATTCTTAGATTAGGTTGA
AGTTGAAGTTGAAAAATAAGCTCCTCCCCCTCCACCTGCTTCTAAATCTAGTAAAAATGA
TGAAGAAGAAGACGATGAAGAGAATGAAAATGAAGATATTGAAGATGATGATGAAGAAGA
AGATGTTGAAGAGGAAGATAAATTTAACGATGAAGTAAAATTAATTAATTAATTAAAATT
TAGCACAAACGTTTAATATTAAATTTCATATTTAAATAGGATAGAAAAAATTCTCTCAGA
ATA