Identifiers and Description

Gene Model Identifier

TTHERM_00243900

Standard Name

SWI1

Aliases

PreTt02385 | 21.m00216

Description

ARID/BRIGHT DNA binding domain containing protein. Member of the SWI/SNF complex.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( PF01388 ) ARID/BRIGHT DNA binding domain
  • ( PF00514 ) Armadillo/beta-catenin-like repeat

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00243900

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_21088.19.997093137033517e-262arid/bright DNA binding domain
-containing protein (654 aa)
OxytrichaContig1044.0.g664.000437458487249e-40ARID/BRIGHT DNA binding domain
DictyBaseDDB_G02753330.0000000000000299873730555305DDB_G0275333 on chromosome: 2
position 5369983 to 5371533
Stentor CoeruleusSteCoe_223030.0000000000006914400106940203
WormBaseWBGene000004760.000000000040005666873964816locus:cfi-1 AT-rich interact
ive domain-containing protein
cfi-1 status:Confirmed Uni
Prot:O02326 protein_id:CAB03
395.3
SGDYMR176W0.000000600201742947405ECM5 Non-essential protein of
unknown function, contains ATP
/GTP-binding site motif A; nul
l mutant exhibits cellular vol
ume up to four times greater t
han wild-type, also large droo
ping buds with elongated necks

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29523178: Saettone A, Garg J, Lambert JP, Nabeel-Shah S, Ponce M, Burtch A, Thuppu Mudalige C, Gingras AC, Pearlman RE, Fillingham J (2018) The bromodomain-containing protein Ibd1 links multiple chromatin-related protein complexes to highly expressed genes in Tetrahymena thermophila. Epigenetics & chromatin 11(1):10

Sequences

>TTHERM_00243900(coding)
ATGAACGAGTCTGAAGAAAGTAAATCCTTTAAGGTCCAGTTAATGGAATACTGGTCATCC
AAAAATATGTCAAATATTAAAATTCCTCAAATTGGAGGACGGGAATTGGACTTCTTTAAA
TTATATAAGGCTGTTATTAAGAGAGGAGGTGCACAAGCTGTTTCTAACAACAAAATGTGG
AAGGAAATAGTCAACGAGTTCGGCTTCCCCTCCACTTGTACATCAGCCTCATTTACTTTG
AGAAACCACTATACTCGTTTCTTGCTAGGTTATGAATAAAAGTACTTTTTCCATAAAGGA
GATGAAGAAGCCATGCCTGTTTTACAAGCTGGACGCAAACGTAAGAGAAAAGATAATCAA
GATAGCAAGCAAGGTGATTCTTCTGAGACAGGATCTGATTCAGAAGAAGCAAAAGACTAA
ATTGAGAAAAAAGTAAAGCCAAACTAGCCTAATAATTTATCGATTGTTTAGCAACCAAAC
AAAGAAGATGTCAAAATATTAAATCAGTAATTTATAAGACCAAACTAATTGAAGTCAAAT
CCTTATCCAGTAATGAGAATGGAACCTCCTAAACAAGAATAAAATAAGAGCACCTTATAT
AAGTAATTAAGTGAAGCATATTAGTTGAATCAAATAAATACAAGACAAGAACTATTCTTC
ACCAGAAAGAACAAAATGTTCCCTATGGTTTAAGACATAAAGAGAATTTCACTTGCCTTC
GAAAGTAGAATATAAGATGAAATAACTTTTGCTCTAAATTAATTACTCCTCTACTCAGTT
AATAGTATGCATCAGTTTACTCTTGAAAGTTATAATCACTTGCTTGAAGGTATTGTCCAA
TATCTAGAAGAGATTATCAAGAATGTACCTTCCCTTAATAAAATTTTGCAACTTAAAGAA
ATTAAACCAAGAACTTTGTAAGAATATGGAGGTACTTCAGACTATAGCTATTCTGGACCT
CCTCCTACAAAAGAGGCATTTAAAGAGCTTTGTATCTTAGACAATTATAACTTCCCTATA
TGTGATATAGTCTTATTTAATTCTTAAAAGAAAAAGGAGGTTTCTCCTATTGTTTTCTTA
CGCAAAAGAAAGCGCTATAATGTTGAAAATCTTAAAGAAATGGCAGGAGAAGTTTATTTG
CTTGAACAAACCCGCACAATCTTTTTAATTTTAAGAAATTTTTCATTTACTAAATCGAAT
GAAGTCTACATGGCTAAAAACGAAAGATTATTATAGATAATGATTTAGCTATTTATCCTT
AATTCAGATTCTTAAATAACAAAATACATATTAGATATCTTGGCTAATATTTCAAAGCAA
ATATAACTTATGAATATTCCCGATTACAAGTTATTCTGTGAAAGGCTCTTTGAATTGCTT
AATGCTGATACAAGTGATGAACTTGAGGCTTGTGTTGACATAATCCGTAATTTGATTGCC
ATCTAAGAAAACGAAAGTATTATCGAAAACTTTTTACCAAAATACATTGACTAAGTAACT
AGACTCATGCTTTAAGCTTAGGGAGATATTAGAGAAGGCATTTTAGAGTTTCTCTGTTTC
CTCAGCGATTTACGTATGGCAACACGTGTTCAATTGGCTCGTCATCCTAAATTAATTATG
AGAATGGTTGGTCTGCTCTCTTCTGGAGTCATGAAATAAAATCGCTAACTTCCAAGCCAT
CTTTAATAACAACAGCACAACTAGCAAGGGGAAGGAGAAAGAAATTCAGAAAAAATTACT
AAATTAGCAGCCTTAACATTAAGTAATATTTCTCTAGCCCCGTTATCTCGTGCATATTTG
AAGCCTTTTGAAAGAGATTTATTTGTTGTAGCCTCAACAGATGAAACAGTAACAAAATAT
ATTTCAAATATTTTGAGTGAACTAATGAACTATGAACCTGAAAGTGATCCTGAAAGATAA
TATATGTTTTAATCAATAAACATGGCAAACATATGA


>TTHERM_00243900(protein)
MNESEESKSFKVQLMEYWSSKNMSNIKIPQIGGRELDFFKLYKAVIKRGGAQAVSNNKMW
KEIVNEFGFPSTCTSASFTLRNHYTRFLLGYEQKYFFHKGDEEAMPVLQAGRKRKRKDNQ
DSKQGDSSETGSDSEEAKDQIEKKVKPNQPNNLSIVQQPNKEDVKILNQQFIRPNQLKSN
PYPVMRMEPPKQEQNKSTLYKQLSEAYQLNQINTRQELFFTRKNKMFPMVQDIKRISLAF
ESRIQDEITFALNQLLLYSVNSMHQFTLESYNHLLEGIVQYLEEIIKNVPSLNKILQLKE
IKPRTLQEYGGTSDYSYSGPPPTKEAFKELCILDNYNFPICDIVLFNSQKKKEVSPIVFL
RKRKRYNVENLKEMAGEVYLLEQTRTIFLILRNFSFTKSNEVYMAKNERLLQIMIQLFIL
NSDSQITKYILDILANISKQIQLMNIPDYKLFCERLFELLNADTSDELEACVDIIRNLIA
IQENESIIENFLPKYIDQVTRLMLQAQGDIREGILEFLCFLSDLRMATRVQLARHPKLIM
RMVGLLSSGVMKQNRQLPSHLQQQQHNQQGEGERNSEKITKLAALTLSNISLAPLSRAYL
KPFERDLFVVASTDETVTKYISNILSELMNYEPESDPERQYMFQSINMANI


>TTHERM_00243900(gene)
ATGAACGAGTCTGAAGAAAGTAAATCCTTTAAGGTCCAGTTAATGGAATACTGGTCATCC
AAAAATATGTCAAATATTAAAATTCCTCAAATTGGAGGACGGGAATTGGACTTCTTTAAA
TTATATAAGGCTGTTATTAAGAGAGGAGGTGCACAAGCTGTTTCTAACAACAAAATGTGG
AAGGAAATAGTCAACGAGTTCGGCTTCCCCTCCACTTGTACATCAGCCTCATTTACTTTG
AGAAACCACTATACTCGTTTCTTGCTAGGTTATGAATAAAAGTACTTTTTCCATAAAGGA
GATGAAGAAGCCATGCCTGTTTTACAAGCTGGACGCAAACGTAAGAGAAAAGATAATCAA
GATAGCAAGCAAGGTGATTCTTCTGAGACAGGATCTGATTCAGAAGAAGCAAAAGACTAA
ATTGAGAAAAAAGTAAAGCCAAACTAGGTAATCATTAAAGACAATTATAATTAAAAATCT
TTTAAAGTTAATTCGAGTATATTTTGCTCATCTATCGCTCTCAAAAGGGAGTTTGTTTTA
GTTTTATAAGTAGGAGTGAATTTATTAGATTAACAATAAACATGCTATATAAAGCATAAT
TTTATAGATTAATAGAAATTTATTAAAATATCTCGTATTTTATAAGAAAATAAAATATTA
TTAAATATTATAATTGCCCTTTAATTACTCTAAAATTATCTCTCACGAGGTTTTTTTATT
CTAAATAATTCGCTTAAATAAGCTAATAAATGTTTCTTTTACTTATTTTTCCTCTTTTCC
AAACCAAACCAAGTATAAAAAATACTCTCAATATTTTGAAGAAACAAATAAAAAAATATG
TTATGCATCCAAAATCTTTATCTTAATAGCAGCAGTAGCTTGCTTTTGAAAATAATAGAT
TTTTATATTTCTAAATAAATAAAAATATTAAATATCACTTATTTGATTATCAATACAAAT
AATACAAGATTTTCAACTTTATTTACAAAATAAAAATGAATTTATTGTTTTTAAAGATAT
TTAATAGGATAGGAATAAACACGTTTATATTAAGAATTTTACTTTTTTTCATAAAGCGCA
GTTCATTTTTAACATAATTTTAAGATAAAATTCAGAATTTAATGATAATAAAACTGATAC
ATAAACATTTAAAACTTAAAAATGAAAATAAATCAAAAATATTATAGCATATTTATTTAA
TTTAATAATTATTTATTTATTTATTTATTTATTTTATCAAAAGCCTAATAATTTATCGAT
TGTTTAGCAACCAAACAAAGAAGATGTCAAAATATTAAATCAGTAATTTATAAGACCAAA
CTAATTGAAGTCAAATCCTTATCCAGTAATGAGAATGGAACCTCCTAAACAAGAATAAAA
TAAGAGCACCTTATATAAGTAATTAAGTGAAGCATATTAGTTGAATCAAATAAATACAAG
ACAAGAACTATTCTTCACCAGAAAGAACAAAATGTTCCCTATGGTTTAAGACATAAAGAG
AATTTCACTTGCCTTCGAAAGTAGAATATAAGATGAAATAACTTTTGCTCTAAATTAATT
ACTCCTCTACTCAGTTAATAGTATGCATCAGTTTACTCTTGAAAGTTATAATCACTTGCT
TGAAGGTATTGTCCAATATCTAGAAGAGATTATCAAGAATGTACCTTCCCTTAATAAAAT
TTTGCAACTTAAAGAAATTAAACCAAGAACTTTGTAAGAATATGGAGGTACTTCAGACTA
TAGCTATTCTGGACCTCCTCCTACAAAAGAGGCATTTAAAGAGCTTTGTATCTTAGACAA
TTATAACTTCCCTATATGTGATATAGTCTTATTTAATTCTTAAAAGAAAAAGGAGGTTTC
TCCTATTGTTTTCTTACGCAAAAGAAAGCGCTATAATGTTGAAAATCTTAAAGAAATGGC
AGGAGAAGTTTATTTGCTTGAACAAACCCGCACAATCTTTTTAATTTTAAGAAATTTTTC
ATTTACTAAATCGAATGAAGTCTACATGGCTAAAAACGAAAGATTATTATAGATAATGAT
TTAGCTATTTATCCTTAATTCAGATTCTTAAATAACAAAATACATATTAGATATCTTGGC
TAATATTTCAAAGCAAATATAACTTATGAATATTCCCGATTACAAGTTATTCTGTGAAAG
GCTCTTTGAATTGCTTAATGCTGATACAAGTGATGAACTTGAGGCTTGTGTTGACATAAT
CCGTAATTTGATTGCCATCTAAGAAAACGAAAGTATTATCGAAAACTTTTTACCAAAATA
CATTGACTAAGTAACTAGACTCATGCTTTAAGCTTAGGGAGATATTAGAGAAGGCATTTT
AGAGTTTCTCTGTTTCCTCAGCGATTTACGTATGGCAACACGTGTTCAATTGGCTCGTCA
TCCTAAATTAATTATGAGAATGGTTGGTCTGCTCTCTTCTGGAGTCATGAAATAAAATCG
CTAACTTCCAAGCCATCTTTAATAACAACAGCACAACTAGCAAGGGGAAGGAGAAAGAAA
TTCAGAAAAAATTACTAAATTAGCAGCCTTAACATTAAGTAATATTTCTCTAGCCCCGTT
ATCTCGTGCATATTTGAAGCCTTTTGAAAGAGATTTATTTGTTGTAGCCTCAACAGATGA
AACAGTAACAAAATATATTTCAAATATTTTGAGTGAACTAATGAACTATGAACCTGAAAG
TGATCCTGAAAGATAATATATGTTTTAATCAATAAACATGGCAAACATATGA