Identifiers and Description

Gene Model Identifier

TTHERM_00136450

Standard Name

SWC5

Aliases

PreTt24370 | 10.m00419 | 3698.m00138 | AOR1

Description

Member of the SWR complex.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF07572 ) Bucentaur or craniofacial development

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.8%

TetraMine Data

TTHERM_00136450

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05812.12.0009580008310955e-119hypothetical protein (302 aa)
OxytrichaContig16954.0.g310.00000000006996681903814525Bucentaur or craniofacial deve
lopment

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29523178: Saettone A, Garg J, Lambert JP, Nabeel-Shah S, Ponce M, Burtch A, Thuppu Mudalige C, Gingras AC, Pearlman RE, Fillingham J (2018) The bromodomain-containing protein Ibd1 links multiple chromatin-related protein complexes to highly expressed genes in Tetrahymena thermophila. Epigenetics & chromatin 11(1):10

Sequences

>TTHERM_00136450(coding)
ATGTCAGAGGGTCTATTAAAAATTAACTTATAAGACTTAGAGGAGGAAGAAGAAGATGAA
GATTATGTTCCTCAAGCAAGCGAAATTGAAGAATACAAGAGAGAAAAGAAAGAACTCAAA
GATTTAAAAAAAAAAAAGAATTAAGAGGAGCTGCATCAAGAGATACTATAATCATGGATT
GAATTAAAGAAGGAAGTTAGAGAAAAAGAAATGAATTAAATAAATGAAATTAGGAAATAA
ACATAGATGCTGTTAAAAGATAAGGATCTTTTACTATAAATAGCCCAAAAAGCACTTCGC
TTAAACGAAGATGATAAATAAAGAAAAGTAATATTCGCTGGTTAAGAGTTTATAGTAGAT
TCTAGTGGTGAAATAGTAGGCAGAGCAGATGAGTAGGCTTATTTAAAAGAATTTTAGCTT
TTTGAAAGCAAGGAAATCAATTAAATGAAATTTGAAGAATCCAAAAATGTCAAAGAAGAA
ATCATCGAAAGCAAAAAGGAAGAACCATAAGAAATAATTATTGAAGAAAATAATAAAGAA
GAAGTGTAAGAAGTCTAAGAAGTCTAAGAAGAAAAAGTAGAAAAAGTAGAAAAAGTTGAA
GTAGTATAAGAAGTAATTTAATAGCTTGGTTAAGAAGAAAAACATAGATTAGATATGAAA
AATAGATTTTAATACTTATAAAAAGTTATGGATAAAATAAATAGTAAATCAAAGAGCATA
ACATCAATACACAAATCAAAACTTGATTGGAAGTCTTTCACTAAAAAAGAAAAGTTGGAA
AAGAAATTCGAACAAAATAGAAAAGCAGGCTATCTAGATAAATAAAATTTCATTGCAAAA
GCCACCGAAAAGCAAAAATAAATTTAAAAGTCAACTAGAAGGTGA


>TTHERM_00136450(protein)
MSEGLLKINLQDLEEEEEDEDYVPQASEIEEYKREKKELKDLKKKKNQEELHQEILQSWI
ELKKEVREKEMNQINEIRKQTQMLLKDKDLLLQIAQKALRLNEDDKQRKVIFAGQEFIVD
SSGEIVGRADEQAYLKEFQLFESKEINQMKFEESKNVKEEIIESKKEEPQEIIIEENNKE
EVQEVQEVQEEKVEKVEKVEVVQEVIQQLGQEEKHRLDMKNRFQYLQKVMDKINSKSKSI
TSIHKSKLDWKSFTKKEKLEKKFEQNRKAGYLDKQNFIAKATEKQKQIQKSTRR


>TTHERM_00136450(gene)
ATGTCAGAGGGTCTATTAAAAATTAACTTATAAGACTTAGAGGAGGAAGAAGAAGATGAA
GATTATGTTCCTCAAGCAAGCGAAATTGAAGAATACAAGAGAGAAAAGAAAGAACTCAAA
GATTTAAAAAAAAAAAAGAATTAAGAGGAGCTGCATCAAGAGATACTATAATCATGGATT
GAATTAAAGAAGGAAGTTAGAGAAAAAGAAATGAATTAAATAAATGAAATTAGGAAATAA
ACATAGATGCTGTTAAAAGATAAGGATCTTTTACTATAAATAGCCCAAAAAGCACTTCGC
TTAAACGAAGATGATAAATAAAGAAAAGTAATATTCGCTGGTTAAGAGTTTATAGTAGAT
TCTAGTGGTGAAATAGTAGGCAGAGCAGATGAGTAGGCTTATTTAAAAGAATTTTAGCTT
TTTGAAAGCAAGGAAATCAATTAAATGAAATTTGAAGAATCCAAAAATGTCAAAGAAGAA
ATCATCGAAAGCAAAAAGGAAGAACCATAAGAAATAATTAGTAATAATTATAAATTTAAT
GCAAGAAATAGCATATAAAATGTATTTTTTAAAATCAGTTGAAGAAAATAATAAAGAAGA
AGTGTAAGAAGTCTAAGAAGTCTAAGAAGAAAAAGTAGAAAAAGTAGAAAAAGTTGAAGT
AGTATAAGAAGTAATTTAATAGCTTGGTTAAGAAGAAAAACATAGATTAGATATGAAAAA
TAGATTTTAATACTTATAAAAAGTTATGGATAAAATAAATAGTAAATCAAAGAGCATAAC
ATCAATACACAAATCAAAACTTGATTGGAAGTCTTTCACTAAAAAAGAAAAGTTGGAAAA
GAAATTCGAACAAAATAGAAAAGCAGGCTATCTAGATAAATAAAATTTCATTGCAAAAGC
CACCGAAAAGCAAAAATAAATTTAAAAGTCAACTAGAAGGTGA