Identifiers and Description

Gene Model Identifier

TTHERM_00388500

Standard Name

SWC2

Aliases

PreTt24845 | 41.m00252

Description

Member of the SWR complex.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF05764 ) YL1 nuclear protein
  • ( TIGR01396 ) flagellar basal-body rod protein FlgB
  • ( PF08555 ) Eukaryotic family of unknown function
  • ( PF08619 ) Alkali metal cation/H+ antiporter Nha1

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.8%

TetraMine Data

TTHERM_00388500

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04476.19.997093137033517e-262hypothetical protein (926 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29523178: Saettone A, Garg J, Lambert JP, Nabeel-Shah S, Ponce M, Burtch A, Thuppu Mudalige C, Gingras AC, Pearlman RE, Fillingham J (2018) The bromodomain-containing protein Ibd1 links multiple chromatin-related protein complexes to highly expressed genes in Tetrahymena thermophila. Epigenetics & chromatin 11(1):10

Sequences

>TTHERM_00388500(coding)
ATGGGAAAGAAAGAAAAGGTTTTCTTTGAGGAGGAAGATGATAACAAGAATGAGGAGATA
TATAATAGCGATTAAGATGATTAAGATTAAACTCCTTAAAACAAATCACATTCAAACAAT
TCTAATTAAGTAGGCGCATAGTCTAAAAAAGGAGCTGTTTAAGATAAATCAGCTAAAAAT
TCTAAAGTCACAGCATCAAAAGGAAATCAAAAGAAGAAATCATAAGAAGTAGATTCAAAA
GCTCCAAAGAAAGGGAAAGCTATTTCAAAAGGCAAAACTAATAAAAAAGGAAAAGACAAA
GGTGGTGCCGCTTCTAAAAAAGGAGGTAAAAAGAAAGTACAAAAAGGTAAAAAAGGAGAA
AAGGCTCCAGTGAAAGGTTCAGCTACTAAAAAAAAAGGAGGTGCTTAAGATAAGAAAAAA
GCAGATAATAGCGCTCTTAAAAAGACAAAAAAAATTTCATAGGGTAAAGCAGAAATCATA
GAAGATGAAAAAGAAGAAGTATTTAATGATGAAAGTAATGCAACTCCTCCTTAATATAGC
TAAACAAATGCTACTTCTTATTAAAGCGATAATATCTCAAAGCTAAAAAAAAAACCAGCT
GCAAAAGCTAGCAATAAAAAAACACAATAAACTCTAGCTGCATCTAAATTAAAAACGCAA
AAAGAGGAATAAGGAGAAAAATCTTCTAGTTTGAAAGCATTTAGCAGCATAATTAAAGAC
AAAAAGAATGGAAAAAACGTTCCTTTCCAGCCTACAGAAAATAAAGAGAGTGAAGAAATA
GAAATAGAACCTGAGACAGATGAATAAGAATCAGATCCTAATTAGCTTAAAAAGAAGCTA
GGTAAATCAGATTTAAATACTGAGCATCAAAATGGTGGAAATTAAGTAAAAGATGATAAA
AAAGGTTAATCTGAATCATCTTTAAAAAATAGAAGCAAGGTCTTAGTTGATAGTAAAAAA
CCTAATTCGAAGCTTTATAAAAATGATAATGGTCATGAATAAAGTACTACTTCTAAAGGG
TCTAAGGTATCTGCTATTAAAAACATAAGAAAGGATAGTTTAGATATGGAATTAGACAAT
ACTTTAGAAAACGAAGAGGATGAAGAAGATATTCTTTCAGGTTCTGAAGATTCTGAAAAT
AGCTAAAACAGTGATAATATAAAAACAAACAAAAAATAATTGGACAAGAAGAAAAGCGAT
AGTTTATCATCAAAACTTAAAAATAAAGCTGATGAAAGTGAAGATGATGGAGAAGGAGAA
GACAATGAAGAAGACGATGAAGTTGATGATGACGAAGAAGACGAAGAGAATGGTGATGAG
GATGATGATGATGACGAAAATGAAGGTGATGATGAAGAAGATAACGATGAAGACGAAAGT
AGTAGTGAAGAAGTAGTTTAGGCTGTAAGAACAATGACATTTCGTAGTAGAAGAGGTGAA
GGCATCAAAAAGCTTATGGAGTTATAAAAAAGAAATGAAGGATTCGGAGATGATTTAGAT
GACTTTTGGAAAGAAAATAAATATTTTGGTAAAATAACTGAAGTTACAAAGGCTAATGAT
GAAGAAGAAGACGAAGATTTTAATGAAGAAGAGTTTAAAGACGTAAAGGATGTATTCGAT
AGTGATTTTTAAGACACTAGTGATTTAGAAGATGATGGCGATGATGATTCAAATATGTCA
GATGAAGATTCAGACAGCGAGAAAAAGAAAAAACGTAATAAAGATAAGCCTAGCTATTTA
ATGAAAAAAGATGATGTTATTAGAAAAGAATAAGAAAAAATAGCAAAGCAGAGACAAAAA
TAAAAAGCTGAGCGCTTGAAATAGCTCGATACCTAAGAAGAAAATGAAATTTAAATATCT
TAAAAGATATAAAAGGAGAAAAGAGAGGCATAGATCACAATTTAGCTTGAAAAACGTACC
TTAAGATAAAGCACAAATGAAAAATCTCTTTTATCTCAAAGTTAGCTTTCTCCTCGTTTA
AAAAAGAAATTGCGCTTAAACGAAGATGGATCTGTAGACATTAATGGGTAATAAGGAGAG
TAAGGTGGATAAGCACAGGGTGCTGGAGGCAAAAAGAAACGTTATATCCATGATTTCTTG
ACCTAAGAGTAACTATTAAAAGAAGCTGTTTTTACAGAATTTGTGAATAGAAAATAATTA
GAAGACTTACTTCGTTTGGAAGAAGAGAAAAAATAATTCTCTTTAAGTAAAAAATTTATA
GACGAAGGACCTAAGATAATATATAAAAACTCTGCTAAAACAGATGAAAATTTAATCATA
TATCCAACATAAGAAGTATATGATAGCACAATAGGTAACTATATGTAATCTTTCAATCAA
TAAAAATAAATAAAAGAAAAAAAATTCCGCTATCACGATCCTAAAACTAATAAATCTTAT
AATACTCCAGAAGAATTTTATAAATATCGTACAATTTTGTATAAGTCAGAGCAAAATCGT
TACAAGTATCTTATTAAAGTTTACAAAGATCTCTAAGAAAAGAAGGAAGAGCTGCTAGAA
GAATTTGAGCCAAAACTTAAAGACAAATATAATAATAATTGTAATAATTCTTCAGATTCA
GATGACTCTTTATCATCATCTTCATAATCCTCATCTAATTCAGCAACTTCTTCTGCAGGT
AAAAAGAAGAAGAGAAAATCTTAATAAAAGAAAAAGAAACAAACTAAGAAAGCAAAAAGT
TAAAAATCTCGTATTTCATAAACTGCAGCTGAAAGAGAAGATGATGAAAATGATGAAGAA
AACGATGATGATAATAATAATAATTAAGATGATAAAATATTTATTGACTAAGATTCAGAT
TGA


>TTHERM_00388500(protein)
MGKKEKVFFEEEDDNKNEEIYNSDQDDQDQTPQNKSHSNNSNQVGAQSKKGAVQDKSAKN
SKVTASKGNQKKKSQEVDSKAPKKGKAISKGKTNKKGKDKGGAASKKGGKKKVQKGKKGE
KAPVKGSATKKKGGAQDKKKADNSALKKTKKISQGKAEIIEDEKEEVFNDESNATPPQYS
QTNATSYQSDNISKLKKKPAAKASNKKTQQTLAASKLKTQKEEQGEKSSSLKAFSSIIKD
KKNGKNVPFQPTENKESEEIEIEPETDEQESDPNQLKKKLGKSDLNTEHQNGGNQVKDDK
KGQSESSLKNRSKVLVDSKKPNSKLYKNDNGHEQSTTSKGSKVSAIKNIRKDSLDMELDN
TLENEEDEEDILSGSEDSENSQNSDNIKTNKKQLDKKKSDSLSSKLKNKADESEDDGEGE
DNEEDDEVDDDEEDEENGDEDDDDDENEGDDEEDNDEDESSSEEVVQAVRTMTFRSRRGE
GIKKLMELQKRNEGFGDDLDDFWKENKYFGKITEVTKANDEEEDEDFNEEEFKDVKDVFD
SDFQDTSDLEDDGDDDSNMSDEDSDSEKKKKRNKDKPSYLMKKDDVIRKEQEKIAKQRQK
QKAERLKQLDTQEENEIQISQKIQKEKREAQITIQLEKRTLRQSTNEKSLLSQSQLSPRL
KKKLRLNEDGSVDINGQQGEQGGQAQGAGGKKKRYIHDFLTQEQLLKEAVFTEFVNRKQL
EDLLRLEEEKKQFSLSKKFIDEGPKIIYKNSAKTDENLIIYPTQEVYDSTIGNYMQSFNQ
QKQIKEKKFRYHDPKTNKSYNTPEEFYKYRTILYKSEQNRYKYLIKVYKDLQEKKEELLE
EFEPKLKDKYNNNCNNSSDSDDSLSSSSQSSSNSATSSAGKKKKRKSQQKKKKQTKKAKS
QKSRISQTAAEREDDENDEENDDDNNNNQDDKIFIDQDSD


>TTHERM_00388500(gene)
ATGGGAAAGAAAGAAAAGGTTTTCTTTGAGGAGGAAGATGATAACAAGAATGAGGAGATA
TATAATAGCGATTAAGATGATTAAGATTAAACTCCTTAAAACAAATCACATTCAAACAAT
TCTAATTAAGTAGGCGCATAGTCTAAAAAAGGAGCTGTTTAAGATAAATCAGCTAAAAAT
TCTAAAGTCACAGCATCAAAAGGAAATCAAAAGAAGAAATCATAAGTAAGATGATTAGAT
TTAAATAATTTTAAAGTGAATTATTGTTCTAAGTATATTAATATTAATTTTATTATCATT
ATCATCATCTAGGAAGTAGATTCAAAAGCTCCAAAGAAAGGGAAAGCTATTTCAAAAGGC
AAAACTAATAAAAAAGGAAAAGACAAAGGTGGTGCCGCTTCTAAAAAAGGAGGTAAAAAG
AAAGTACAAAAAGGTAAAAAAGGAGAAAAGGCTCCAGTGAAAGGTTCAGCTACTAAAAAA
AAAGGAGGTGCTTAAGATAAGAAAAAAGCAGATAATAGCGCTCTTAAAAAGACAAAAAAA
ATTTCATAGGGTAAAGCAGAAATCATAGAAGATGAAAAAGAAGAAGTATTTAATGATGAA
AGTAATGCAACTCCTCCTTAATATAGCTAAACAAATGCTACTTCTTATTAAAGCGATAAT
ATCTCAAAGCTAAAAAAAAAACCAGCTGCAAAAGCTAGCAATAAAAAAACACAATAAACT
CTAGCTGCATCTAAATTAAAAACGCAAAAAGAGGAATAAGGAGAAAAATCTTCTAGTTTG
AAAGCATTTAGCAGCATAATTAAAGACAAAAAGAATGGAAAAAACGTTCCTTTCCAGCCT
ACAGAAAATAAAGAGAGTGAAGAAATAGAAATAGAACCTGAGACAGATGAATAAGAATCA
GATCCTAATTAGCTTAAAAAGAAGCTAGGTAAATCAGATTTAAATACTGAGCATCAAAAT
GGTGGAAATTAAGTAAAAGATGATAAAAAAGGTTAATCTGAATCATCTTTAAAAAATAGA
AGCAAGGTCTTAGTTGATAGTAAAAAACCTAATTCGAAGCTTTATAAAAATGATAATGGT
CATGAATAAAGTACTACTTCTAAAGGGTCTAAGGTATCTGCTATTAAAAACATAAGAAAG
GATAGTTTAGATATGGAATTAGACAATACTTTAGAAAACGAAGAGGATGAAGAAGATATT
CTTTCAGGTTCTGAAGATTCTGAAAATAGCTAAAACAGTGATAATATAAAAACAAACAAA
AAATAATTGGACAAGAAGAAAAGCGATAGTTTATCATCAAAACTTAAAAATAAAGCTGAT
GAAAGTGAAGATGATGGAGAAGGAGAAGACAATGAAGAAGACGATGAAGTTGATGATGAC
GAAGAAGACGAAGAGAATGGTGATGAGGATGATGATGATGACGAAAATGAAGGTGATGAT
GAAGAAGATAACGATGAAGACGAAAGTAGTAGTGAAGAAGTAGTTTAGGCTGTAAGAACA
ATGACATTTCGTAGTAGAAGAGGTGAAGGCATCAAAAAGCTTATGGAGTTATAAAAAAGA
AATGAAGGATTCGGAGATGATTTAGATGACTTTTGGAAAGAAAATAAATATTTTGGTAAA
ATAACTGAAGTTACAAAGGCTAATGATGAAGAAGAAGACGAAGATTTTAATGAAGAAGAG
TTTAAAGACGTAAAGGATGTATTCGATAGTGATTTTTAAGACACTAGTGATTTAGAAGAT
GATGGCGATGATGATTCAAATATGTCAGATGAAGATTCAGACAGCGAGAAAAAGAAAAAA
CGTAATAAAGATAAGCCTAGCTATTTAATGAAAAAAGATGATGTTATTAGAAAAGAATAA
GAAAAAATAGCAAAGCAGAGACAAAAATAAAAAGCTGAGCGCTTGAAATAGCTCGATACC
TAAGAAGAAAATGAAATTTAAATATCTTAAAAGATATAAAAGGAGAAAAGAGAGGCATAG
ATCACAATTTAGCTTGAAAAACGTACCTTAAGATAAAGCACAAATGAAAAATCTCTTTTA
TCTCAAAGTTAGCTTTCTCCTCGTTTAAAAAAGAAATTGCGCTTAAACGAAGATGGATCT
GTAGACATTAATGGGTAATAAGGAGAGTAAGGTGGATAAGCACAGGGTGCTGGAGGCAAA
AAGAAACGTTATATCCATGATTTCTTGACCTAAGAGTAACTATTAAAAGAAGCTGTTTTT
ACAGAATTTGTGAATAGAAAATAATTAGAAGACTTACTTCGTTTGGAAGAAGAGAAAAAA
TAATTCTCTTTAAGTAAAAAATTTATAGACGAAGGACCTAAGATAATATATAAAAACTCT
GCTAAAACAGATGAAAATTTAATCATATATCCAACATAAGAAGTATATGATAGCACAATA
GGTAACTATATGTAATCTTTCAATCAATAAAAATAAATAAAAGAAAAAAAATTCCGCTAT
CACGATCCTAAAACTAATAAATCTTATAATACTCCAGAAGAATTTTATAAATATCGTACA
ATTTTGTATAAGTCAGAGCAAAATCGTTACAAGTATCTTATTAAAGTTTACAAAGATCTC
TAAGAAAAGAAGGAAGAGCTGCTAGAAGAATTTGAGCCAAAACTTAAAGACAAATATAAT
AATAATTGTAATAATTCTTCAGATTCAGATGACTCTTTATCATCATCTTCATAATCCTCA
TCTAATTCAGCAACTTCTTCTGCAGGTAAAAAGAAGAAGAGAAAATCTTAATAAAAGAAA
AAGAAACAAACTAAGAAAGCAAAAAGTTAAAAATCTCGTATTTCATAAACTGCAGCTGAA
AGAGAAGATGATGAAAATGATGAAGAAAACGATGATGATAATAATAATAATTAAGATGAT
AAAATATTTATTGACTAAGATTCAGATTGA