Identifiers and Description

Gene Model Identifier

TTHERM_00046120

Standard Name

SUB1 (transcriptional coactivator SUB1)

Aliases

PreTt11091 | 3.m01995 | 3824.m02852

Description

RNA polymerase II transcriptional coactivator p15 (PC4); involved in transcriptional coactivation of RNA polymerase II; localizes to transcriptionally-active nucleus

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00046120

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01838.16.002397656030775e-43RNA polymerase II transcriptio
nal coactivator (86 aa)
WormBaseWBGene000117430.00000000000040012475857291343Putative RNA polymerase II tra
nscriptional coactivator sta
tus:Confirmed UniProt:Q94045
protein_id:CAB03353.1
OxytrichaContig2932.0.g320.000000000010004361180063202Transcriptional Coactivator p1
5 (PC4)
SGDYMR039C0.000000009996807949091551SUB1 Transcriptional coactivat
or, facilitates elongation thr
ough factors that modify RNAP
II; role in peroxide resistanc
e involving Rad2p; role in the
hyperosmotic stress response
through polymerase recruitment
at RNAP II and RNAP III genes
DictyBaseDDB_G02753350.00000005001214305021125DDB_G0275335 on chromosome: 2
position 5382119 to 5382860

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000126

Sequences

>TTHERM_00046120(coding)
ATGAGTGACAACGAAGAAAAAAAGGAAGTTAAGCCCATAAAAGGTGACGATGGCAGTTTA
TACTTTGAGCTTGATGACAAAAAAAGAGTTACTGTAAGAAAATTTAAAGGTAAATTATAT
GTTGACATCAGAGAGTTTTATGAAAAAGATGGTGAAATGCTTCCTGGAAAAAAAGGTATT
TCCTTAAATTTATAAAATTGGGAACAATTCAGAAGCTTAATTGACAGTATTGATTAATGC
ATAACTGATATTTGA


>TTHERM_00046120(protein)
MSDNEEKKEVKPIKGDDGSLYFELDDKKRVTVRKFKGKLYVDIREFYEKDGEMLPGKKGI
SLNLQNWEQFRSLIDSIDQCITDI


>TTHERM_00046120(gene)
ATGAGTGACAACGAAGAAAAAAAGGAAGTTAAGCCCATAAAAGGTGACGATGGCAGTTTA
TACTTTGAGGTATCTTAAATTAATAACAGTTAATACTTCATATATATAACTTAAATATTT
TTTTTATAAAGCTTGATGACAAAAAAAGAGTTACTGTAAGAAAATTTAAAGGTAAATTAT
ATGTTGACATCAGAGAGTTTTATGAAAAAGATGGTGAAATGCTTCCTGGAAAAAAAGGTA
TAATAAAATACTATTAAATTGTATTAAATTCATTTGGAAAATGTATTGATTAACATCTTA
TTTATTTAGGTATTTCCTTAAATTTATAAAATTGGGAACAATTCAGAAGCTTAATTGACA
GTATTGATTAATGCATAACTGATATTTGA