Identifiers and Description

Gene Model Identifier

TTHERM_00046120

Standard Name

SUB1 (Transcriptional Coactivator SUB1)

Aliases

PreTt11091 | 3.m01995 | 3824.m02852

Description

RNA polymerase II transcriptional coactivator p15 (PC4)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00046120

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01838.16.002397656030775e-43RNA polymerase II transcriptio
nal coactivator (86 aa)
WormBaseWBGene000117430.00000000000040012475857291343Putative RNA polymerase II tra
nscriptional coactivator sta
tus:Confirmed UniProt:Q94045
protein_id:CAB03353.1
OxytrichaContig2932.0.g320.000000000010004361180063202Transcriptional Coactivator p1
5 (PC4)
SGDYMR039C0.000000009996807949091551SUB1 Transcriptional coactivat
or, facilitates elongation thr
ough factors that modify RNAP
II; role in peroxide resistanc
e involving Rad2p; role in the
hyperosmotic stress response
through polymerase recruitment
at RNAP II and RNAP III genes
DictyBaseDDB_G02753350.00000005001214305021125DDB_G0275335 on chromosome: 2
position 5382119 to 5382860

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000126

Sequences

>TTHERM_00046120(coding)
ATGAGTGACAACGAAGAAAAAAAGGAAGTTAAGCCCATAAAAGGTGACGATGGCAGTTTA
TACTTTGAGCTTGATGACAAAAAAAGAGTTACTGTAAGAAAATTTAAAGGTAAATTATAT
GTTGACATCAGAGAGTTTTATGAAAAAGATGGTGAAATGCTTCCTGGAAAAAAAGGTATT
TCCTTAAATTTATAAAATTGGGAACAATTCAGAAGCTTAATTGACAGTATTGATTAATGC
ATAACTGATATTTGA


>TTHERM_00046120(protein)
MSDNEEKKEVKPIKGDDGSLYFELDDKKRVTVRKFKGKLYVDIREFYEKDGEMLPGKKGI
SLNLQNWEQFRSLIDSIDQCITDI


>TTHERM_00046120(gene)
ATGAGTGACAACGAAGAAAAAAAGGAAGTTAAGCCCATAAAAGGTGACGATGGCAGTTTA
TACTTTGAGGTATCTTAAATTAATAACAGTTAATACTTCATATATATAACTTAAATATTT
TTTTTATAAAGCTTGATGACAAAAAAAGAGTTACTGTAAGAAAATTTAAAGGTAAATTAT
ATGTTGACATCAGAGAGTTTTATGAAAAAGATGGTGAAATGCTTCCTGGAAAAAAAGGTA
TAATAAAATACTATTAAATTGTATTAAATTCATTTGGAAAATGTATTGATTAACATCTTA
TTTATTTAGGTATTTCCTTAAATTTATAAAATTGGGAACAATTCAGAAGCTTAATTGACA
GTATTGATTAATGCATAACTGATATTTGA