Identifiers and Description

Gene Model Identifier

TTHERM_00420770

Standard Name

STX7L1 (SyTaXin 7 Like 1)

Aliases

PreTt07202 | 46.m00257 | 3679.m00107

Description

Syntaxin; required for mucocyst biogenesis; homolog of H. sapiens STX7

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00420770

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11001.19.996261361959507e-120hypothetical protein (249 aa)
SGDYOR106W0.0007003012208360162VAM3 Syntaxin-like vacuolar t-
SNARE that functions with Vam7
p in vacuolar protein traffick
ing; mediates docking/fusion o
f late transport intermediates
with the vacuole; has an acid
ic di-leucine sorting signal a
nd C-terminal transmembrane re
gion

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:28381425: Kaur H, Sparvoli D, Osakada H, Iwamoto M, Haraguchi T, Turkewitz AP (2017) An endosomal syntaxin and the AP-3 complex are required for formation and maturation of candidate lysosome-related secretory organelles (mucocysts) in Tetrahymena thermophila. Molecular biology of the cell 28(11):1551-1564

Sequences

>TTHERM_00420770(coding)
ATGTCCTTCCAATAAAGTTCAAAAGAAAATAGGCTTAATACATCAAATTTATAGAATGGA
AAAAATTAAAAAAGCTAGGAAGATGGATTCTTTAGCGAAGTGCAAAGTTTGTTTGCAGAA
ATTTAAAAAAACATTTAGATATAAAACTATGGAGATTGCTGTAATGTAGAAGAAAACAAT
CAAATTATTCAAGAGAACGAAAAGCTAATGAAAAAAATAAAAAATATTTTATAACAAGAG
ATAGCCAGAGATAAAAAAAACCAAAATAAAGGATATATACTGTAGTGCGAAAAGTAGTTA
TAAATGTTTCAAAAAAAAATAAATGCTTCAAAGTAAAAACTTCAAGAATTAATAAGATAG
TAGCACTAAGAAGCAGAAGATGATGAAGAAAATGGTTTTTTATAGGAAAAATAAGTTATG
AATGACATGGATTTTATTTTATACGAAGAAACATTAGATTAAAGAAAAGAGAGAATGGAA
AATGCACATAGATAAATGAGAGCTGTTCATACTATCTATTAGCAAATAGATAATATAACT
GCATAATAAAGTTAGTAATTAAAGGTAATAGATGGACATATTGAAAGCACTTTCTCAAAT
ACAAAAGATACAAATAAAGAATTAGTTAGAGCAAAATAAAATCTTGATAAAAAGAACAAA
AACAATTTTAATATGCTATTTATCTTAATAGTAGTTTTAGTGGTTATGATTATCTTTATA
AGTTATAAATGA


>TTHERM_00420770(protein)
MSFQQSSKENRLNTSNLQNGKNQKSQEDGFFSEVQSLFAEIQKNIQIQNYGDCCNVEENN
QIIQENEKLMKKIKNILQQEIARDKKNQNKGYILQCEKQLQMFQKKINASKQKLQELIRQ
QHQEAEDDEENGFLQEKQVMNDMDFILYEETLDQRKERMENAHRQMRAVHTIYQQIDNIT
AQQSQQLKVIDGHIESTFSNTKDTNKELVRAKQNLDKKNKNNFNMLFILIVVLVVMIIFI
SYK


>TTHERM_00420770(gene)
ATTGATTATCTTTTGTTATCAAAAAAAAAATAGTTAAATTTGTAATTAATATTAATTAAT
TGTGTTTTTTAATCATAATCTTCAAGTTAAAAAATTGATAATATGTCCTTCCAATAAAGT
TCAAAAGAAAATAGGCTTAATACATCAAATTTATAGAATGGAAAAAATTAAAAAAGCTAG
GAAGATGGTAGATTTAGTTTAACTAAAATATTATGTACTCATATCAAAAATAAAATAGGA
TTCTTTAGCGAAGTGCAAAGTTTGTTTGCAGAAATTTAAAAAAACATTTAGATATAAAAC
TATGGAGATTGCTGTAATGTAGAAGAAAACAATCAAATTATTCAAGAGAACGAAAAGCTA
ATGAAAAAAATAAAAAATATTTTATAACAGTAAATTGAAAGTTATATTTTGTAAATATTT
ATTTGATTAAAGCACACATATACAAATAGAGAGATAGCCAGAGATAAAAAAAACCAAAAT
AAAGGATATATACTGTAGTGCGAAAAGTAGTTATAAATGTTTCAAAAAAAAATAAATGCT
TCAAAGTAAAAACTTCAAGAATTAATAAGATAGTAGCACTAAGAAGCAGAAGATGGTATA
AATTAAATTTATTGTAATTTCCTTTGATTTTCATTCATATAATTTTAAAAAAAGATGAAG
AAAATGGTTTTTTATAGGAAAAATAAGTTATGAATGACATGGATTTTATTGTAAAATATA
ATTAATATATTAATTTGGATATTAACAAATACTTTTTTAAAGTTATACGAAGAAACATTA
GATTAAAGAAAAGAGAGAATGGAAAATGCACATAGATAAATGAGAGCTGTAAGCAAACAA
TATAAATAAGTGCTGTTTATTCAAATATTATTATTAATTAAATAGGTTCATACTATCTAT
TAGCAAATAGATAATATAACTGCATAATAAAGTTAGTAATTAAAGGTAATAGATGGACAT
ATTGAAAGCACTTTCTCAAATACAAAGTAAATCTTTGATTCAAAAAAAAATAGAATTAAA
TGGCTATTTTTTAAATTTATTTAGAGATACAAATAAAGAATTAGTTAGAGCAAAATAAAA
TCTTGATAAAAAGAACAAAAACAATTTTAATATGCTATTTATCTTAATAGTAGTTTTAGT
GGTTATGATTATCTTTATAAGTTATAAATGA