Identifiers and Description

Gene Model Identifier

TTHERM_00131260

Standard Name

STP1 (Standard Transport Protein)

Aliases

PreTt24247 | 10.m00296 | 3698.m00020

Description

major facilitator superfamily protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF03600 ) Citrate transporter
  • ( PF01956 ) Integral membrane protein
  • ( PF01925 ) Domain of unknown function
  • ( TIGR00898 ) cation transport protein
  • ( TIGR00893 ) d-galactonate transporter
  • ( PF02673 ) undecaprenol kinase, putative
  • ( TIGR00880 ) Multidrug resistance protein
  • ( PF07690 ) transporter, major facilitator family
  • ( PF00083 ) transporter, major facilitator superfamily
  • ( TIGR00879 ) MFS transporter, sugar porter (SP)
  • ( TIGR00881 ) phosphoglycerate transporter family protein
  • ( PF00902 ) Sec-independent protein translocase protein (TatC)
  • ( TIGR00895 ) MFS transporter, aromatic acid:H+ symporter
  • ( TIGR00883 ) MFS transporter, metabolite:H+ symporter (MHS)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.4%

TetraMine Data

TTHERM_00131260

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05687.19.997093137033517e-262major facilitator superfamily
transporter protein (511 aa)
OxytrichaContig12280.0.g233.9997566980151843e-38Sugar (and other) transporter
DictyBaseDDB_G02777739.995528898049344e-31DDB_G0277773 on chromosome: 2
position 8461506 to 8463173
SGDYDR497C2.0009605191578312e-25ITR1 Myo-inositol transporter
with strong similarity to the
minor myo-inositol transporter
Itr2p, member of the sugar tr
ansporter superfamily; express
ion is repressed by inositol a
nd choline via Opi1p and derep
ressed via Ino2p and Ino4p
Stentor CoeruleusSteCoe_46611.9287498479639178e-22
WormBaseWBGene000130736.000675497867615e-22locus:hmit-1.1 status:Partia
lly_confirmed UniProt:Q9XXR3
protein_id:CAA16400.1

General Information

Paragraph NoGene NameParagraph Text
36STP1This protein is the in domain of sugar transporter with an E-value of 1.5X10-66, indicating that the sequence contains strongly conserved amino acids typical of the domain. . These types of transporters come from the Major Facilitator Superfamily (MFS) that are responsible for binding and then transporting several different molecules such as sugars, carbohydrates, and small, biological acids. While much is unknown about this specific transporter, it most likely is involved in the binding and transport of sugars across the cell membrane. Written by Jessica Thomas and Paul Gonzalez, undergraduates at the Keck Science Department of Claremont McKenna, Pitzer, and Scripps Colleges.

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00131260(coding)
ATGTAGCAAAAGTAAGAACAATTGCACAAATCAACGCTCTAGGTATTTATAATTACCTAG
ATTGCTTGCTTTGGAGGCTTTCTTTATGGATATGTTATCTCTGAGCTCACTATCGTTTAT
GATTAACTAGCTATTGCTTTTGGAGTTGATAAGTATAAAGATAATTAAATTTATAATGAA
GAAACTCCTGATGATTATACATCTGAATTCCACAACTTAAAAACGATTTGCACAGTTTTT
ATGCCTATTGGTGCTCTTGTTAGCAGCTACATTGGCAAGTTTATCATAAACAAGATGGGT
AGAAGATAGTACATGATGCTTAGTGATATCATAATGATTACAGGATGTGCAATCGCTATG
ATAAGCAATTTATATTCTTTCCTAGTTGCCAGATTCATCTTAGGTTATGCAGTTGGTATG
AATACTGCGGTAGTTCCTCTTTATGTCAAAGAAATGTCCCCTGTTTCTATATCTGGACTT
ACTGGTTCTATCTTCCAAATTAACATCAACTTAGGTATTATTTTATCGATTTGCATCAGT
CTTGGATTAAATCAAGTTGTTAGCAACAGCACTCCTGTTTAGGGTATTTGGAGATTGATT
ATAGTCTTCCCTGCTATTTTCTCTACCTTACGTCTACTTGGCTTGATATTTTACTCTCGT
ACTGACACGCCTTTCTACTACTTTTCAAGAGGTATGGTAGATTAAGGAACTGAGGTTTTA
AAGTCTATTTACAAAGAAGAATATGTTGAAGAGATAAAATAGACTATGACTCAAACAAAT
GATGGCGATGATGGTGTTTAGGATCAAAATTAAGAGAAAAATACAGCTTCATACAAAAGA
CGTTTACTTGTAGGAGTTTGCATTCAATTTTTTTGTTAAATGACAGGTATAAATGCAGTT
ATATAGTTTTCAAACAACATATTTGGTTTAGTAACTTCAAATTATACTACAATCAATTAT
TTAACTCTTTCTAGTAATATCTTTTTGATGTTTGCTGCATTTTTAGGCTCTTCCCTTTCT
GTCAAATTTGGTAGAAAGGTTATCCTATAAGGAGGTTACCTTTCTTGCTCTATCCTTCTC
TTAACATTTGGTATAATAGCCTTCTTTAATGTTAAAGATTACGTTGGTCTATAAGTCGTA
TCTATAATTATTATCTTCATTTTTTACGCTTGCTTTAATTGCTCTATAGGGCCAGTTACC
TGGATATTTAACAGTGATATTGTTAAAGAAGAAGGAATGAGCTACGGTGTACTTTCTAAT
TGGTTCGGTAACATAGTAAGTACTCTCATAAATCTGAACTCAATAATACAAATAAATTTC
TTAGTATTTGGAGGTTTTAGCACAGTTGGGCTTCTATTTATAACAAAGTTTGTCCTTGAA
ACAAAGGATAAGACTTATCCAGAAATACAAAGAATCTATGCAGCTGGTAAGGATGGAGAA
AAATAAGAATTATTAGATAATTGA


>TTHERM_00131260(protein)
MQQKQEQLHKSTLQVFIITQIACFGGFLYGYVISELTIVYDQLAIAFGVDKYKDNQIYNE
ETPDDYTSEFHNLKTICTVFMPIGALVSSYIGKFIINKMGRRQYMMLSDIIMITGCAIAM
ISNLYSFLVARFILGYAVGMNTAVVPLYVKEMSPVSISGLTGSIFQININLGIILSICIS
LGLNQVVSNSTPVQGIWRLIIVFPAIFSTLRLLGLIFYSRTDTPFYYFSRGMVDQGTEVL
KSIYKEEYVEEIKQTMTQTNDGDDGVQDQNQEKNTASYKRRLLVGVCIQFFCQMTGINAV
IQFSNNIFGLVTSNYTTINYLTLSSNIFLMFAAFLGSSLSVKFGRKVILQGGYLSCSILL
LTFGIIAFFNVKDYVGLQVVSIIIIFIFYACFNCSIGPVTWIFNSDIVKEEGMSYGVLSN
WFGNIVSTLINLNSIIQINFLVFGGFSTVGLLFITKFVLETKDKTYPEIQRIYAAGKDGE
KQELLDN


>TTHERM_00131260(gene)
ATGTAGCAAAAGTAAGAACAATTGCACAAATCAACGCTCTAGGTATTTATAATTACCTAG
ATTGCTTGCTTTGGAGGCTTTCTTTATGGATATGTTATCTCTGAGCTCACTATCGTTTAT
GATTAACTAGCTATTGCTTTTGGAGTTGATAAGTATAAAGATAATTAAATTTATAATGAA
GAAACTCCTGATGATTATACATCTGAATTCCACAACTTAAAAGTAAATAATATTTAGTAT
TTCTTATCTAATAATGTTAAAATATATTATTTAAGACGATTTGCACAGTTTTTATGCCTA
TTGGTGCTCTTGTTAGCAGCTACATTGGCAAGTTTATCATAAACAAGATGGGTAGAAGAT
AGTACATGATGCTTAGTGATATCATAATGATTACAGGATGTGCAATCGCTATGATAAGCA
ATTTATATTCTTTCCTAGTTGCCAGATTCATCTTAGGTTATGCAGTTGGTATGAATACTG
CGGTAGTTCCTCTTTATGTCAAAGAAATGTCCCCTGTTTCTATATCTGGACTTACTGGTT
CTATCTTCCAAATTAACATCAACTTAGGTATTATTTTATCGATTTGCATCAGTCTTGGAT
TAAATCAAGTTGTTAGCAACAGCACTCCTGTTTAGGGTATTTGGAGATTGATTATAGTCT
TCCCTGCTATTTTCTCTACCTTACGTCTACTTGGCTTGATATTTTACTCTCGTACTGACA
CGCCTTTCTACTACTTTTCAAGAGGTATGGTAGATTAAGGAACTGAGGTTTTAAAGTCTA
TTTACAAAGAAGAATATGTTGAAGAGATAAAATAGACTATGACTCAAACAAATGATGGCG
ATGATGGTGTTTAGGATCAAAATTAAGAGAAAAATACAGCTTCATACAAAAGACGTTTAC
TTGTAGGAGTTTGCATTCAATTTTTTTGTTAAATGACAGGTATAAATGCAGTTATATAGT
TTTCAAACAACATATTTGGTTTAGTAACTTCAAATTATACTACAATCAATTATTTAACTC
TTTCTAGTAATATCTTTTTGATGTTTGCTGCATTTTTAGGCTCTTCCCTTTCTGTCAAAT
TTGGTAGAAAGGTTATCCTATAAGGAGGTTACCTTTCTTGCTCTATCCTTCTCTTAACAT
TTGGTATAATAGCCTTCTTTAATGTTAAAGATTACGTTGGTCTATAAGTCGTATCTATAA
TTATTATCTTCATTTTTTACGCTTGCTTTAATTGCTCTATAGGGCCAGTTACCTGGATAT
TTAACAGTGATATTGTTAAAGAAGAAGGAATGAGCTACGGTGTACTTTCTAATTGGTTCG
GTAACATAGTAAGTACTCTCATAAATCTGAACTCAATAATACAAATAAATTTCTTAGTAT
TTGGAGGTTTTAGCACAGTTGGGCTTCTATTTATAACAAAGTTTGTCCTTGAAACAAAGG
ATAAGACTTATCCAGAAATACAAAGAATCTATGCAGCTGGTAAGGATGGAGAAAAATAAG
AATTATTAGATAATTGA