Identifiers and Description

Gene Model Identifier

TTHERM_00532680

Standard Name

STK1 (Serine/Threonine Kinase 1)

Aliases

PreTt19924 | 68.m00213 | 3830.m00577

Description

Serine/Threonine kinase; regulates ciliary growth; localizes to basal bodies and oral apparatus

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00532680

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11870.19.997093137033517e-262protein kinase domain-containi
ng protein (403 aa)
OxytrichaContig22618.0.g461.0004236668521093e-146Protein kinase domain
DictyBaseDDB_G02721103.001349705199738e-130gskA on chromosome: 2 position
1334436 to 1336255
WormBaseWBGene000017469.995516318087232e-125locus:gsk-3 Glycogen synthas
e kinase-3 status:Confirmed
UniProt:Q9U2Q9 protein_id:
CAA22311.1
SGDYMR139W6.999576669079256e-104RIM11 Protein kinase required
for signal transduction during
entry into meiosis; promotes
the formation of the Ime1p-Ume
6p complex by phosphorylating
Ime1p and Ume6p; shares simila
rity with mammalian glycogen s
ynthase kinase 3-beta
Stentor CoeruleusSteCoe_78211.4411565509640892e-64

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,
  2. Ref:SUPR000134

Sequences

>TTHERM_00532680(coding)
ATGAAGGTGAATAAAAATTATATGAATATGAGGATTCCTACTCAAAATTATGATAAGGAA
GTACTTCCAACATAGGCTGATGAAGGAATAGGTTCCAGAGTCCATACAGTTGGATCTATG
AAAGAAAATGAATACCAAAAGAAGTAGTAATAAAAGTAGTAAGCTGGCAACTATACTTAT
ACCATTGTTGGAGATGAAGATAAAGTAGTTGGAAGTGGTACATTTGGAGTTGTGTATTAA
GCAACCACTAAAGAAACAGGAGAAGTTGTTGCTATCAAAAAAGTTTTCCAAGACAAAAGG
TACAAAAATAGAGAATTGCAAATGATGAAAGAAATCGGTAACCACCCTAACGTTATCAAA
CTAAGAAATCATTATTACTCTTATGGAAATAGTACTGATGATGTTTATTTGCATTTGGTA
ATGGACTTTGTTCCAGAGACCCTCTACAAAATGATTAAATATTACAGCAAAAAACACAAA
GGAAATTTCCCTAATATATTACTTAAATACTATTCTTACTAAATGCTTAGATCTCTTGCC
TATATTCATGGAATTAACATTTGTCATAGAGATATAAAACCTCAAAATATATTAGTTGAT
CCAAGAAATCACAATCTTAAAATGTGCGATTTTGGTTCTGCAAAAAAACTTGTCCCAGGT
GAATCCAACATTTCCTACATTTGTAGCAGGTGCTATAGAGCTCCAGAGTTAATGTTTTAA
GCAACTCAATACACTCATGCTATTGATGTCTGGTCAGTAGGATGTGTGATAGCTGAAATG
GTATTAGGATAGCCCATATTCATAGGAGAATCTAGTGTTGATTAGCTCATTGAAATAATA
AAAGTGTTAGGTACACCAACTTAATAACAAATATTTGCAATGAATCCTGATCACCAAGGT
ACTAAAATGCCTAATATTAAGCCTACTCCTTGGACTAAAGTTTTCTAAAATTGTAGAATT
GATCCCCTTGCTATTGATTTGATATCTAAGATCTTAGTTTATAACCCAGAAAAACGTTTA
AAACCCTTAGAAGCATTATTACATCCTTTCTTTGAGGAATTAAGAAATCCCAAATGCAGG
ATCAATGGAAAACCACTCGATAATCTGTTTAACTTCACAGAAGCTGAAATAGGCCCAAAT
GAGGAATTGCTATAAAGGCTTATTCCTGACTGGTATGTCTAACAGCTTACTGAAGCATAA
AATCAATACTGA


>TTHERM_00532680(protein)
MKVNKNYMNMRIPTQNYDKEVLPTQADEGIGSRVHTVGSMKENEYQKKQQQKQQAGNYTY
TIVGDEDKVVGSGTFGVVYQATTKETGEVVAIKKVFQDKRYKNRELQMMKEIGNHPNVIK
LRNHYYSYGNSTDDVYLHLVMDFVPETLYKMIKYYSKKHKGNFPNILLKYYSYQMLRSLA
YIHGINICHRDIKPQNILVDPRNHNLKMCDFGSAKKLVPGESNISYICSRCYRAPELMFQ
ATQYTHAIDVWSVGCVIAEMVLGQPIFIGESSVDQLIEIIKVLGTPTQQQIFAMNPDHQG
TKMPNIKPTPWTKVFQNCRIDPLAIDLISKILVYNPEKRLKPLEALLHPFFEELRNPKCR
INGKPLDNLFNFTEAEIGPNEELLQRLIPDWYVQQLTEAQNQY


>TTHERM_00532680(gene)
ATGAAGGTGAATAAAAATTATGTAAGAAATAAAAAAATTGGATTATATCATTTTTTAAAA
TAGAAACAGAATGAAAATAATTTTTTTGAATAAATATTTATTTTTTAATATTTTCTATAA
GCTATTTCTAAACAATAATTTTATTGCAAGCAGCTTTGAATAATTAGCAAGTTTCCTTTT
TAATATTTTGAAAATATTCTTTCTAAAATAAAGATGAATATGAGGATTCCTACTCAAAAT
TATGATAAGGAAGTACTTCCAACATAGGCTGATGAAGGAATAGGTTCCAGAGTCCATACA
GTTGGATCTATGAAAGAAAATGAATACCAAAAGAAGTAGTAATAAAAGGTATACATTTTA
AAGTTTATTGTTTTATCGTTGAGAACGATTAAGGAATATATTACGTATTTTTAGATTTAA
ATGACATATTTTTATAATGAAAAGTAGTAAGCTGGCAACTATACTTATACCATTGTTGGA
GATGAAGATAAAGTAGTTGGAAGTGGTACATTTGGAGTTGTGTATTAAGTAAACTTTTTT
TTGCAATCTATTTTTGATACTTTCAGTTGAAAAAAAATAGATTAAGACTTATTTTTATGC
TGTTATTAAACTAACGATATAAATTTTAAAAAGGCAACCACTAAAGAAACAGGAGAAGTT
GTTGCTATCAAAAAAGTTTTCCAAGACAAAAGGTACAAAAATAGAGAATTGCAAATGATG
AAAGAAATCGGTAACCACCCTAACGTTATCAAACTAAGAAATCATTATTACTCTTATGGA
AATAGTGTAAATAAATAAATAAATGAATAAAATTTGATTTCAATAAATGTTATTTTAAAT
TTTTATTAAAATTACCTCTAAAAATAAAAATCAAAGAGAGAAATTACAATTTAGTTGATA
TTCTTTTAAAATTGTTAATAATTTAAGGAGATTAAATTGCATAAAATGAATATTAACAAA
TAGCTTTTAATTTTATTATTTGATTAAATTTTAAACTGCCATACTAAATTCTCAAAACGA
GATTAATTGATAACTTTTAAAATTCATTTATTATTATTATCATTCACACTCATCTATAAT
GTTAATCAAATTAATTATTATTTAAAAGACTGATGATGTTTATTTGCATTTGGTAATGGA
CTTTGTTCCAGAGACCCTCTACAAAATGATTAAATATTACAGCAAAAAACACAAAGGAAA
TTTCCCTAATATATTACTTAAATACTATTCTTACTAAATGCTTAGATCTCTTGCCTATAT
TCATGGAATTAACATTTGTCATAGAGATATAAAACCTCAAAATATATTAGTTGATCCAAG
AAATCACAATCTTAAAATGTGCGATTTTGGTTCTGCAAAAAAACTTGTCCCAGGTGAATC
CAACATTTCCTACATTTGTAGCAGGTATTTAATTTAAAAACTTAAATAAAAAATATTAAA
TACGTTATTATTTGAATAGGTGCTATAGAGCTCCAGAGTTAATGTTTTAAGCAACTCAAT
ACACTCATGCTATTGATGTCTGGTCAGTAGGATGTGTGATAGCTGAAATGGTATTAGGAT
AGCCCATATTCATAGGAGAATCTAGTGTTGATTAGCTCATTGAAATAATAAAAGTGTTAG
GTACACCAACTTAATAACAAGTAATTAATTAACCTAATTATTTTTCAAAATATACATACA
CCGAATTGCATTCTAACTTATTTACTTATTTACTCATTTAATAATTTTTTTTATTTAATA
ATGTAAAATCTAGATATTTGCAATGAATCCTGATCACCAAGGTACTAAAATGCCTAATAT
TAAGCCTACTCCTTGGACTAAAGTTTTCTAAAATTGTAGAATTGATCCCCTTGCTATTGA
TTTGATATCTAAGATCTTAGTTTATAACCCAGAAAAACGTTTAAAACCCTTAGAAGCATT
ATTACATCCTTTCTTTGAGGAATTAAGAAATCCCAAATGCAGGATCAATGGAAAACCACT
CGATAATCTGTTTAACTTCACAGAAGGTAAATTAATAAATTATTTTTTTTTATTATGCTA
AATAGATTAAAATATTTTAACAAAAAATAGCTGAAATAGGCCCAAATGAGGAATTGCTAT
AAAGGCTTATTCCTGACTGGTATGTCTAACAGCTTACTGAAGCATAAAATCAATACTGA