Identifiers and Description

Gene Model Identifier

TTHERM_01049310

Standard Name

STD1 (Sugar Transport and Distribution)

Aliases

PreTt17689 | 211.m00057 | 3758.m00226

Description

major facilitator superfamily protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( TIGR01885 ) ornithine--oxo-acid transaminase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01049310

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20454.19.997093137033517e-262major facilitator superfamily
transporter protein (704 aa)
OxytrichaContig12280.0.g239.99723014177113e-33Sugar (and other) transporter
DictyBaseDDB_G02782619.997019043202629e-21DDB_G0278261 on chromosome: 3
position 577308 to 579437
WormBaseWBGene000199792.0004286606204839e-16status:Partially_confirmed U
niProt:O44616 protein_id:CCD
68888.1
Stentor CoeruleusSteCoe_46610.000000000000001713908431542013
SGDYDR497C0.0000000006000548789370351ITR1 Myo-inositol transporter
with strong similarity to the
minor myo-inositol transporter
Itr2p, member of the sugar tr
ansporter superfamily; express
ion is repressed by inositol a
nd choline via Opi1p and derep
ressed via Ino2p and Ino4p

General Information

Paragraph NoGene NameParagraph Text
44STD1Tetrahymena thermophila STD1 (Sugar Transport and Distribution) is homologous to proteins from the major facilitator/general substrate transporter superfamily of proteins. It contains a single domain (E-value = 9.6 * 10-42) categorized as “sugar_tr,” which is responsible for sugar and other solute transportation across a membrane. This implies that STD1 integral membrane protein may be involved in the transport of sugars across the T. thermophila membrane. Paragraph by Daivik Vyas and Katie Liu, Keck Science Department, Claremont McKenna College and Scripps College.

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01049310(coding)
ATGACTGAAAATTGTCAAAATATTCCATCTCTTGCTGTAATAGATTTCTAATTAAACAAG
GACAAAGAAACTACTTCAGCTATCAACAACCAAAAGGATGAGCCTTAATAAGAAAAAATG
ATTTTAAATACCTTTAGATTTTGGTGTTTATTTTTCCATTCAAGCTGCTTTACTTTCTTC
TCTGGATATGTCACTGCAGAGTTCAACACTATGTTAAATCATCTACCACACATTTATGGC
TGGGATGATAGTGAAAAATCAATGTATAGCAACCTTTGCAACTCACTTCCTATGCTTGGA
GCTGCAAGTATAGCTTTTTGGAGTGGAGAGTTTGCTTAAAAATTCGGAAGAAGAAAATCC
CTTATGTTCTTTAGCGTTGTACTAATTATCGGTAGTATCTTGACACTATTTAGAAATACT
CCATTATTAATAATAGGAAGAATACTTCAAGGAAGTACTTTTGCCATATTTTCAACCGTC
TCACCTTTATATAGCCAGGAAGTCTTAGTTACTGAATATCGCGCTAAGAGTGGTACTTTA
ATTAGTGGATGTTAAGGTTTGGGAGTATTAACTGCATTTTTGATGGGATTTGGATTACCA
TCTGATCCTGCTGACACTGAAAATAAATTTTTCTATGTTCCATTGAGCTTACCTGCTATT
TTAATGGCCATTCATCTTCTTTTGTTCATATTTGTTTTCAAGGATGAGACACCAACTTTT
TACTTACTTTAAAAGAATGACTATTAAAGTGCTTAGAACTTCTTCTCAAAACTTTATGGT
TAATCTTATGTTGAAAGAGAAATGGAAGCTATTTCAGCAGTAAAGAAAGAAAATGAAGAA
GTCGATAAGTAAAAGAAAATTAGCTTTTGCGACTTATTCAATTAGAAATATAGATATAGA
ACTCTTCTTGCATTAGAATTAAATGTAACTTCGGTTTACACAGCAGTTTCGGTACTCTCT
GTTTATTCTACTTAAATATTTGAGAATAGTTATTCAACTAATGTAGCAACCATGTTTTCC
ATAGCAACTACTTTAGGAGATATACTATTACCTCCTCTATCTAACAAGATTATTAATTGG
TTTGGAAAAAAGAACTCTTGCATATATGGATGCTTTGGTCTGATTCTTTGTGAGTGTATT
TTTAGCGGTCTAGGATTTGCTGGACAAGAAAAGGCTATGGCTTTCTTCATTATTATTCAC
AGATTGGTTTTCTCTTTGACTGTTGGACCATTTAATTGGAGTTATCCATATGAGATATGT
CCTCCTGAAGGATTGGGAATATATATTATGCAGTTTTATGTCCTTATGTATATTAGTTTA
TACACTTTCCCTTTGCTAGTTTCATCATTTGGATTAGAAGCTGCATTTTTAGTTTATGCT
GGTATTATGCTAATTAGCACTCTAATTAATATGAAATATGTGCAACATATTGATAACTGC
ACTATTAAAGATATCTAAGATATGTTTGATTTACGTAAAATAAAAACACTAGTAAACTTA
AGCGACTATAATACTTCTCCTTCTCACAAAAGATTTAACCGTAGAAACATGTCTTCTAAA
CCACCAACGATTGTTTTAACTTCTCTTGCAAATATTAAAGACTGTGAAGATGGAGAAATG
CCAACCAATTCTAATAAATAAGCAACTGAATAAAATATAAATGGTGGAAGTCCAACAAAC
AAACTTCATAATTTTGAAAACAGCAATAACAGTAATACTGGTACTTTTATTTTTAGTAGC
TCTGGAAGCTAAGCTTACCTGAGCAATTCTCCTTTACGCTAGAGTCCATTAAAAAGAGGA
AGTAAAAAATAAAAATCTGCTATAATCATGTAAAAAGTAGTCAGCAACAAGCAAGATCTA
GAGGTAGTTTAAGAAGTAAATAATGAGTAATTAAATAACAAGCTGGATTAATCTTAACCA
GGCTAAACAAACAACAAATAAGAATAGTAATAAGAAGGTACAGTTTTCGATAACATAGCT
TAAGTAAGAAAAGTAAGCAAAACAATTAATATTCCTTAAACTTCAGATAGATAATAATAA
GATGCCATACAAGTTATATAATAATAAGGAGAAACTTCTACAAACTAAACTGATAAAATA
GTTAAATTTTAAGAATAATCATGA


>TTHERM_01049310(protein)
MTENCQNIPSLAVIDFQLNKDKETTSAINNQKDEPQQEKMILNTFRFWCLFFHSSCFTFF
SGYVTAEFNTMLNHLPHIYGWDDSEKSMYSNLCNSLPMLGAASIAFWSGEFAQKFGRRKS
LMFFSVVLIIGSILTLFRNTPLLIIGRILQGSTFAIFSTVSPLYSQEVLVTEYRAKSGTL
ISGCQGLGVLTAFLMGFGLPSDPADTENKFFYVPLSLPAILMAIHLLLFIFVFKDETPTF
YLLQKNDYQSAQNFFSKLYGQSYVEREMEAISAVKKENEEVDKQKKISFCDLFNQKYRYR
TLLALELNVTSVYTAVSVLSVYSTQIFENSYSTNVATMFSIATTLGDILLPPLSNKIINW
FGKKNSCIYGCFGLILCECIFSGLGFAGQEKAMAFFIIIHRLVFSLTVGPFNWSYPYEIC
PPEGLGIYIMQFYVLMYISLYTFPLLVSSFGLEAAFLVYAGIMLISTLINMKYVQHIDNC
TIKDIQDMFDLRKIKTLVNLSDYNTSPSHKRFNRRNMSSKPPTIVLTSLANIKDCEDGEM
PTNSNKQATEQNINGGSPTNKLHNFENSNNSNTGTFIFSSSGSQAYLSNSPLRQSPLKRG
SKKQKSAIIMQKVVSNKQDLEVVQEVNNEQLNNKLDQSQPGQTNNKQEQQQEGTVFDNIA
QVRKVSKTINIPQTSDRQQQDAIQVIQQQGETSTNQTDKIVKFQEQS


>TTHERM_01049310(gene)
ATGACTGAAAATTGTCAAAATATTCCATCTCTTGCTGTAATAGATTTCTAATTAAACAAG
GACAAAGAAACTACTTCAGCTATCAACAACCAAAAGGATGAGCCTTAATAAGAAAAAATG
ATTTTAAATACCTTTAGATTTTGGTGTTTATTTTTCCATTCAAGCTGCTTTACTTTCTTC
TCTGGATATGTCACTGCAGAGTTCAACACTATGTTAAATCATCTACCACACATTTATGGC
TGGGATGATAGTGAAAAATCAATGTATAGCAACCTTTGCAACTCACTTCCTATGCTTGGA
GCTGCAAGTATAGCTTTTTGGAGTGGAGAGTTTGCTTAAAAATTCGGAAGAAGAAAATCC
CTTATGTTCTTTAGCGTTGTACTAATTATCGGTAGTATCTTGACACTATTTAGAAATACT
CCATTATTAATAATAGGTATGCATGCATATTACATTCTATTCTATTTTTGATTACTTCAA
AATTTAATTAAATAAATAAAACAAAAAATCAAAATAAAAAAATGAATAAAAAAAATGGTA
TTAAAGAAAATTATTTTAATAAATAGGAAGAATACTTCAAGGAAGTACTTTTGCCATATT
TTCAACCGTCTCACCTTTATATAGCCAGGAAGTCTTAGTTACTGAATATCGCGCTAAGAG
TGGTACTTTAATTAGTGGATGTTAAGGTTTGGGAGTATTAACTGCATTTTTGATGGTAAA
TAATATTTTTTACATAAAAAGCTGTTTATTTATCTAATTAATTAATTATTTATATATTTA
TAATTAGGGATTTGGATTACCATCTGATCCTGCTGACACTGAAAATAAATTTTTCTATGT
TCCATTGAGCTTACCTGCTATTTTAATGGCCATTCATCTTCTTTTGTTCATATTTGTTTT
CAAGGATGAGACACCAACTTTTTACTTACTTTAAAAGAATGACTATTAAAGTGCTTAGAA
CTTCTTCTCAAAACTTTATGGTTAATCTTATGTTGAAAGAGAAATGGAAGCTATTTCAGC
AGTAAAGAAAGAAAATGAAGAAGTCGATAAGTAAAAGAAAATTAGCTTTTGCGACTTATT
CAATTAGAAATATAGATATAGAACTCTTCTTGCATTAGAATTAAATGTAACTTCGGTTTA
CACAGCAGTTTCGGTACTCTCTGTTTATTCTACTTAAATATTTGAGAATAGTTATTCAAC
TAATGTAGCAACCATGTTTTCCATAGCAACTACTTTAGGAGATATACTATTACCTCCTCT
ATCTAACAAGATTATTAATTGGTTTGGAAAAAAGAACTCTTGCATATATGGATGCTTTGG
TCTGATTCTTTGTGAGTGTATTTTTAGCGGTCTAGGATTTGCTGGACAAGAAAAGGCTAT
GGCTTTCTTCATTATTATTCACAGATTGGTTTTCTCTTTGACTGTTGGACCATTTAATTG
GAGTAACTTAACTTATATTTTTTGTTTTTACTATTTAAAGCAGAAAAAATATTTTGTCAT
TTTAATAGATTTAAAACATTTTTTAATTATAATTTAATTAATTTATAGGTTATCCATATG
AGATATGTCCTCCTGAAGGATTGGGAATATATATTATGCAGTTTTATGTCCTTATGTATA
TTAGTTTATACACTTTCCCTTTGCTAGTTTCATCATTTGGATTAGAAGCTGCATTTTTAG
TTTATGCTGGTATTATGCTAATTAGCACTCTAATTAATATGAAATATGTGCAACATATTG
ATAACTGCACTATTAAAGATATCTAAGATATGTTTGATTTACGTAAAATAAAAACACTAG
TAAACTTAAGCGACTATAATACTTCTCCTTCTCACAAAAGATTTAACCGTAGAAACATGT
CTTCTAAACCACCAACGATTGTTTTAACTTCTCTTGCAAATATTAAAGACTGTGAAGATG
GAGAAATGCCAACCAATTCTAATAAATAAGCAACTGAATAAAATATAAATGGTGGAAGTC
CAACAAACAAACTTCATAATTTTGAAAACAGCAATAACAGTAATACTGGTACTTTTATTT
TTAGTAGCTCTGGAAGCTAAGCTTACCTGAGCAATTCTCCTTTACGCTAGAGTCCATTAA
AAAGAGGAAGTAAAAAATAAAAATCTGCTATAATCATGTAAAAAGTAGTCAGCAACAAGC
AAGATCTAGAGGTAGTTTAAGAAGTAAATAATGAGTAATTAAATAACAAGCTGGATTAAT
CTTAACCAGGCTAAACAAACAACAAATAAGAATAGTAATAAGAAGGTACAGTTTTCGATA
ACATAGCTTAAGTAAGAAAAGTAAGCAAAACAATTAATATTCCTTAAACTTCAGATAGAT
AATAATAAGATGCCATACAAGTTATATAATAATAAGGAGAAACTTCTACAAACTAAACTG
ATAAAATAGTTAAATTTTAAGAATAATCATGA