Identifiers and Description

Gene Model Identifier

TTHERM_00579270

Standard Name

SSS1 (Sec61-gamma subunit of protein SSS1)

Aliases

PreTt05820 | 78.m00192 | 3733.m00087

Description

Subunit of the Sec61p translocation complex

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00584 ) SecE/Sec61-gamma subunits of protein translocation
  • ( TIGR00327 ) protein translocase SEC61 complex gamma

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00579270

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16338.12.0008536325002377e-42protein transporter SEC61 gamm
a-1 subunit (74 aa)
WormBaseWBGene000013035.9971655715910366e-21locus:emo-1 Protein transpor
t protein Sec61 subunit gamma
status:Confirmed UniProt:Q
19967 protein_id:CAA98458.1
DictyBaseDDB_G02877779.99946582325553e-18sec61g on chromosome: 5 positi
on 682723 to 683036
OxytrichaContig3371.0.0.g494.997543945741262e-17SecE/Sec61-gamma subunits of p
rotein translocation complex
SGDYDR086C0.0000000000000030004923591262316SSS1 Subunit of the Sec61p tra
nslocation complex (Sec61p-Sss
1p-Sbh1p) that forms a channel
for passage of secretory prot
eins through the endoplasmic r
eticulum membrane, and of the
Ssh1p complex (Ssh1p-Sbh2p-Sss
1p); interacts with Ost4p and
Wbp1p

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00579270(coding)
ATGTCCTCTGACTCTAAGAACGAAGTCCAAAGCCTTGTCAAGAGCGCTATCGATTTTGCT
GAAGAATCCAAGAGATTCGTCAAGAAGTGCACCAAGCCCAATGCCAAAGAATTAAAGAAG
ACTGCCATGTACTGTGCTCTCGGTTTCGCTGTTATGGGTGTTGTTGGTTACTTGATTAAG
TTAGTTTTCATCCCCATCAATAATATTATCCTTTCTCAATGA


>TTHERM_00579270(protein)
MSSDSKNEVQSLVKSAIDFAEESKRFVKKCTKPNAKELKKTAMYCALGFAVMGVVGYLIK
LVFIPINNIILSQ


>TTHERM_00579270(gene)
ATGTCCTCTGACTCTAAGAACGAAGTCCAAAGCCTTGTCAAGAGCGCTATCGATTTTGCT
GAAGAATCCAAGAGATTCGTCAAGAAGTGCACCAAGCCCAATGCCAAAGGTACTTTTTTG
GTCTGATTGAAACCAGAATATTCAGCAAAATCCTTTTTCACTTTAAAACTAACGCTGTTT
TTAATAGCTGAATAGTTTTGATAGCAATTTTTGAAAATAATTTCATTCATTAACTTGCAA
TATTAACCCATTTTTTCTATTATTACAGAATTAAAGAAGACTGCCATGTACTGTGCTCTC
GGTTTCGCTGTTATGGGTGTTGTTGGTTACTTGATTAAGTTAGTTTTCATCCCCATCAAT
AATATTATCCTTTCTCAATGA