Identifiers and Description

Gene Model Identifier

TTHERM_00171850

Standard Name

SSA6 (HSP70a paralog)

Aliases

PreTt29794 | 14.m00361

Description

dnak protein BiP

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF06723 ) MreB/Mbl protein
  • ( PF00012 ) DnaK family protein
  • ( TIGR02350 ) chaperone protein DnaK
  • ( PF01968 ) hydantoinase/oxoprolinase
  • ( PF02491 ) cell division protein FtsA
  • ( TIGR01174 ) cell division protein FtsA
  • ( TIGR01991 ) Fe-S protein assembly chaperone HscA
  • ( TIGR00904 ) cell shape determining protein, MreB/Mrl
  • ( TIGR02529 ) ethanolamine utilization protein EutJ family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14.1%

TetraMine Data

TTHERM_00171850

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_174630
WormBaseWBGene000020079.997093137033517e-262locus:hsp-3 Heat shock 70 kD
a protein C status:Confirmed
UniProt:P27420 protein_id
:CCD64632.1
Tetrahymena borealisEI9_09958.19.997093137033517e-262dnak protein BiP (1236 aa)
DictyBaseDDB_G02764459.997093137033517e-262DDB_G0276445 on chromosome: 2
position 6984336 to 6986396
OxytrichaContig10574.0.g679.997093137033517e-262Hsp70 protein
SGDYBL075C9.997093137033517e-262SSA3 ATPase involved in protei
n folding and the response to
stress; plays a role in SRP-de
pendent cotranslational protei
n-membrane targeting and trans
location; member of the heat s
hock protein 70 (HSP70) family
; localized to the cytoplasm

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00171850(coding)
ATGAAAATTTTTAAAAAATTTATGAACTCCCCACACGTGTAAATTTTGCATTTTTAAGAG
TTGAGTTTTAAATTGGGAATAAATTAAAAGAAAAAAAAATAATTAATTTAATTTACAAAA
GATATTATTTATAATTTAAAAATAAAAGAGGAGATGAATAAAAAATTATTAATCTTCATT
GCCACTGTTTTAATTGTTGGCCTTGTCTATGCAGCTGATGATGAAAAGAAGAAGGTTGAA
TGCCCTGTCATTGGTATCGATTTGGGTACAACCTACTCTTGTGTCGGTGTCTACAAAAAG
GGTTAAGTAGAAATCATTCCTAACGAATTAGGTCATAGAATTACTCCCTCAGTCGTAGCC
TTTACTGATGAAGAAAGACTCGTCGGTGAATCAGCTAAGAACTAAGCCGTTAACAACCCT
ACCAGAACTTTATACGACGTTAAGAGACTTATTGGTCGTAAATACACCGATAAGACTGTC
TAATACGACAAGAAGTTCCTTCCCTACGAAATTATTGAAAAGAATGGAAAGCCTTACATC
AAGGTTGACAACGTCAGAGGTGAAACCAAGGTCTATGCCGCCGAAGAAATCTCTGCTATG
GTCCTCGTCAAGATGAAGGAAATCGCTGAAACCTTCTTGGGTACCACTGTCAAGAACGCC
GTCGTTACCGTCCCCGCTTACTTCAATGATGCCCAAAGACAATCTACCAAGGATGCTGGT
GCCATCGCTGGTTTGGATGTTTAGAGAATTTTGAACGAACCTACCGCCGCTGCCATCGCT
TACGGTTTGGATAAGAAGCAAGGTGAAAAGAACATTTTGGTCTTCGATTTGGGTGGTGGT
ACTTTTGATGTCTCCATCTTAACTATTGATGAAGGTGTTTTCGAAGTTATTGCTACTTCT
GGTGATACTCACTTGGGTGGTGCTGATTTTGATCAAAGAGTTATGGACTACTTCATTAAG
CTCACCAAGAAGAAACACAACAGAGATATTTCTGGTGACAAGAGAGCTATCCAAAAATTG
AAAAGAGAAGTTGAAAATGCCAAGAGAAAGCTTTCTTCTACCATGACTGCCTAAATCGAA
ATTGAAGATTTAGTCGAAGGTTTGGACTTCAATGAAGAACTCACTAGAGCTAAATTCGAA
GAATTGAACGCTGACTTATTCAAGAAGACCATCGGTCCCGTCCAAACTGCCTTGGAAGAC
TCTGGTTTCAAGAAGACTGATATTCACGAAATCGTCTTAGTTGGTGGTTCTACTCGTATC
CCCAAGATCAGAAAGCTCGTCCAAGATTTCTTCGGTAAGGAACCTAACACTGGTATTAAC
CCCGATGAAGCCGTTGCTTACGGTGCTGCCGTCCAAGGTGGTATCATCTGTGGTGAAACC
TTCAGTGAACCTATCGTTATGATTGATGCTACTCCCCTCTCCTTAGGTATTGAAACCGTC
GGTGGTGTTATGTCTACCATCATTCCCAGAAACTCCGTCTCCCCCACCAAGAAGACTTAA
ACTTTCACCACCTATCAAGATAACCAAGAAACCGTCACTATTCAAATCTTTGAAGGTGAA
AGACCTATGACCAAGGACAATCACTTGTTGGGTAAGTTTGATCTCACTGGTATCCCTGCT
GCTCCCAGAGGTCAACCCCAAATTGAAGTTACCTTCGAAGTCGATGTCAACGGTATCTTA
CAAGTTAGCGCTGTTGAAAAATCCGCTGGTGTCAAGAACCAAGTTACTATTACCAACGAC
TCTAGTAGACTTTCTAAGGAAGAAATCGAAAAAATGCTTGATGATGCCAAGAAATTCGAA
GCTCAAGATAAGGTCGCCAAGGAAAGAATCGACGCTAAGAACTCTTTGGATTCTTACGTC
CACTCTATGAGAAACACCGTTGAAGACGAAGCTAAGCTCGCCAACAAAATTAATGAAGAT
GACAAGAAAACCATTAAGGACGCTCTTAAAGAAACTTAAGACTGGCTCTCCGCTAACCCT
GAAGCTGATAAAGAAGAATATGAAGAAAGAAAGACCAAACTTGAAGGTATCTGTAACCCT
ATTATTAGTAAGGCTCACCAATAAGCTGGTGGTTCCTCCCACGCTGATGAAGATGTTAAT
GTCGATCTTTGA


>TTHERM_00171850(protein)
MKIFKKFMNSPHVQILHFQELSFKLGINQKKKKQLIQFTKDIIYNLKIKEEMNKKLLIFI
ATVLIVGLVYAADDEKKKVECPVIGIDLGTTYSCVGVYKKGQVEIIPNELGHRITPSVVA
FTDEERLVGESAKNQAVNNPTRTLYDVKRLIGRKYTDKTVQYDKKFLPYEIIEKNGKPYI
KVDNVRGETKVYAAEEISAMVLVKMKEIAETFLGTTVKNAVVTVPAYFNDAQRQSTKDAG
AIAGLDVQRILNEPTAAAIAYGLDKKQGEKNILVFDLGGGTFDVSILTIDEGVFEVIATS
GDTHLGGADFDQRVMDYFIKLTKKKHNRDISGDKRAIQKLKREVENAKRKLSSTMTAQIE
IEDLVEGLDFNEELTRAKFEELNADLFKKTIGPVQTALEDSGFKKTDIHEIVLVGGSTRI
PKIRKLVQDFFGKEPNTGINPDEAVAYGAAVQGGIICGETFSEPIVMIDATPLSLGIETV
GGVMSTIIPRNSVSPTKKTQTFTTYQDNQETVTIQIFEGERPMTKDNHLLGKFDLTGIPA
APRGQPQIEVTFEVDVNGILQVSAVEKSAGVKNQVTITNDSSRLSKEEIEKMLDDAKKFE
AQDKVAKERIDAKNSLDSYVHSMRNTVEDEAKLANKINEDDKKTIKDALKETQDWLSANP
EADKEEYEERKTKLEGICNPIISKAHQQAGGSSHADEDVNVDL


>TTHERM_00171850(gene)
ATGAAAATTTTTAAAAAATTTATGAACTCCCCACACGTGTAAATTTTGCATTTTTAAGAG
TTGAGTTTTAAATTGGGAATAAATTAAAAGAAAAAAAAATAATTAATTTAATTTACAAAA
GATATTATTTATAATTTAAAAATAAAAGAGGAGATGAATAAAAAATTATTAATCTTCATT
GCCACTGTTTTAATTGTTGGCCTTGTCTATGCAGCTGATGATGAAAAGAAGAAGGTTGAA
TGCCCTGTCATTGGTATCGATTTGGGTACAACCTACTCTTGTGTCGGTGTCTACAAAAAG
GGTTAAGTAGAAATCATTCCTAACGAATTAGGTAATTATTTGTCTTTTAATTTCACACTT
TATCAAACATTAAAAAATATGAAAATAAATGAAACAATTTTTGGATTATTTTGTCATCCC
ATGAAGGAATGACAAATGTAATTCATCTATTCAATAATATGACTTACAAATGTCTTAAAC
ATCTAACTTATTCTTTGTTAAACATTAATACAGGTCATAGAATTACTCCCTCAGTCGTAG
CCTTTACTGATGAAGAAAGACTCGTCGGTGAATCAGCTAAGAACTAAGCCGTTAACAACC
CTACCAGAACTTTATACGACGTTAAGAGACTTATTGGTCGTAAATACACCGATAAGACTG
TCTAATACGACAAGAAGTTCCTTCCCTACGAAATTATTGAAAAGAATGGAAAGCCTTACA
TCAAGGTTGACAACGTCAGAGGTGAAACCAAGGTCTATGCCGCCGAAGAAATCTCTGCTA
TGGTCCTCGTCAAGATGAAGGTAAATATAACAAAAATAATATATTCATCAAGACTTACCT
TTCAGCTATTCAACCCAAGCTTCATTCACTCTATAATATATTTACCTAAAATAAAGAATG
AAATTTTCTTTTTAAATTTTACTCTCTAAAAATACAAAAAAATAAGATACTTCTAATTTA
AGACAACCTCAAAGAAATGTCAATAAAATTATAAGCAATAACTATTCAAAATATAAGTGA
AAATTATTCTAAACATTCAATTCATAAGTTCACCAGCAGCACTCTAATAAGCTAAGAGCA
AAAGACTAACTTAAATAAATCAGCAGAATTTATTTAAATTTAAAAATGACTTATGAAAAG
ACTCAAAAGTGAATGAGTGATGTATTATTTATCTATCATTTAGCAAATAAAATATTAAGT
AGAAGATAAGTTAGTGAGAGTCTATTTTATTAGATAATTAGTAAATAAATGCAATAAATA
AATACAATAAATAATATAAATAAAGGAGAATTCATTAGTTATTAATAGTATTAGCGAAAA
AAATTTAAAAAGCTGAAAGATATTTATTTATTTATTATTTGATTGATAATTTAACTTAAA
AATTTTAAATAAAAATTATTTAAATAACATAATAGGAAATCGCTGAAACCTTCTTGGGTA
CCACTGTCAAGAACGCCGTCGTTACCGTCCCCGCTTACTTCAATGATGCCCAAAGACAAT
CTACCAAGGATGCTGGTGCCATCGCTGGTTTGGATGTTTAGAGAATTTTGAACGAACCTA
CCGCCGCTGCCATCGCTTACGGTTTGGATAAGAAGCAAGGTGAAAAGAACATTTTGGTCT
TCGATTTGGGTGGTGGTACTTTTGATGTCTCCATCTTAACTATTGATGAAGGTGTTTTCG
AAGTTATTGCTACTTCTGGTGATACTCACTTGGGTGGTGCTGATTTTGATCAAAGAGTTA
TGGACTACTTCATTAAGCTCACCAAGAAGAAACACAACAGAGATATTTCTGGTGACAAGA
GAGCTATCCAAAAATTGAAAAGAGAAGTTGAAAATGCCAAGAGAAAGCTTTCTTCTACCA
TGACTGCCTAAATCGAAATTGAAGATTTAGTCGAAGGTTTGGACTTCAATGAAGAACTCA
CTAGAGCTAAATTCGAAGAATTGAACGCTGACTTATTCAAGAAGACCATCGGTCCCGTCC
AAACTGCCTTGGAAGACTCTGGTTTCAAGAAGACTGATATTCACGAAATCGTCTTAGTTG
GTGGTTCTACTCGTATCCCCAAGATCAGAAAGCTCGTCCAAGATTTCTTCGGTAAGGAAC
CTAACACTGGTATTAACCCCGATGAAGCCGTTGCTTACGGTGCTGCCGTCCAAGGTGGTA
TCATCTGTGGTGAAACCTTCAGTGAACCTATCGTTATGATTGATGCTACTCCCCTCTCCT
TAGGTATTGAAACCGTCGGTGGTGTTATGTCTACCATCATTCCCAGAAACTCCGTCTCCC
CCACCAAGAAGACTTAAACTTTCACCACCTATCAAGATAACCAAGAAACCGTCACTATTC
AAATCTTTGAAGGTGAAAGACCTATGACCAAGGACAATCACTTGTTGGGTAAGTTTGATC
TCACTGGTATCCCTGCTGCTCCCAGAGGTCAACCCCAAATTGAAGTTACCTTCGAAGTCG
ATGTCAACGGTATCTTACAAGTTAGCGCTGTTGAAAAATCCGCTGGTGTCAAGAACCAAG
TTACTATTACCAACGACTCTAGTAGACTTTCTAAGGAAGAAATCGAAAGTAAGATTTTTA
AATATTTAGAATTTCTGAAATTTTATAATTTCAGAATTATTAGCTTCAAAAATTTATTTC
AACTTATTGACTGATTTATTTACTTATTTAATTAATTAATTAGAAATGCTTGATGATGCC
AAGAAATTCGAAGCTCAAGATAAGGTCGCCAAGGAAAGAATCGACGCTAAGAACTCTTTG
GATTCTTACGTCCACTCTATGAGAAACACCGTTGAAGACGAAGCTAAGCTCGCCAACAAA
ATTAATGAAGATGACAAGAAAACCATTAAGGACGCTCTTAAAGAAACTTAAGACTGGCTC
TCCGCTAACCCTGAAGCTGATAAAGAAGAATATGAAGAAAGAAAGACCAAACTTGAAGGG
TAATTAATTAATTTTTTATTCTAAATAGAAATACGATTAATCAAACTAATATTAATTTTC
ATTTTTATAAAATAGTATCTGTAACCCTATTATTAGTAAGGCTCACCAATAAGCTGGTGG
TTCCTCCCACGCTGATGAAGATGTTAATGTCGATCTTTGA