Identifiers and Description

Gene Model Identifier

TTHERM_01080440

Standard Name

SSA4 (HSP70a paralog)

Aliases

PreTt02086 | 222.m00042 | 3798.m00199

Description

dnaK protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.5%

TetraMine Data

TTHERM_01080440

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_9940
WormBaseWBGene000020059.997093137033517e-262locus:hsp-1 Heat shock 70 kD
a protein A status:Confirmed
UniProt:P09446 protein_id
:CAB02319.1
Tetrahymena borealisEI9_14409.19.997093137033517e-262dnaK protein (647 aa)
DictyBaseDDB_G02691449.997093137033517e-262hspB on chromosome: 1 position
4410084 to 4412006
OxytrichaContig18685.0.g309.997093137033517e-262Hsp70 protein
SGDYER103W9.997093137033517e-262SSA4 Heat shock protein that i
s highly induced upon stress;
plays a role in SRP-dependent
cotranslational protein-membra
ne targeting and translocation
; member of the HSP70 family;
cytoplasmic protein that conce
ntrates in nuclei upon starvat
ion

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:25586926: Fukuda Y, Akematsu T, Attiq R, Tada C, Nakai Y, Pearlman RE (2015) Role of the Cytosolic Heat Shock Protein 70 Ssa5 in the Ciliate Protozoan Tetrahymena thermophila. The Journal of eukaryotic microbiology 62(4):481-93

Sequences

>TTHERM_01080440(coding)
ATGTCTAAAAACAAAAAAGCTGAAGGAGTTGCTGTCGGTATTGATCTAGGAACTACCTAT
TCTTGTGTAGGTGTTTTTTAAAACGATAGAGTAGAAATAATTGCTAATGACTAAGGAAAT
AGAACAACTCCATCTTATGTTGCTTTCACAGATACTGAGAGACTTATAGGAGATGCTGCT
AAAAACTAAACAGCTAGAAACCCTACAAATACAATATTTGATGCCAAAAGATTGATTGGA
AGAAAATTTAGTGATCCAATAGTTTAAAAAGACATTAAATTATGGCCATTTAAAGTAGAA
GCTGGTATTGATGACAAGCCTTTAATTGTTGTTAAATTTAAAGGAGAAACAAAAAAATTC
CATGCTGAAGAAATATCATCAATGGTTCTTACAAAAATGAAAGAAACAGCAGAAGCATTC
GTTTCCTAACCTGTTAAGAATGCAGTTATTACTGTTCCTGCTTATTTTAATGATTCATAA
AGATAAGCCACAAAAGATGCTGGTGCTATAGCAGGATTAAATGTTCTCAGAATCATAAAT
GAGCCTACTGCTGCAGCTATTGCTTACGGATTAGATAAAAAGTAATAAGGCGAAAAGAAT
ATTTTAATTTTTGATTTGGGTGGAGGTACCTTCGATGTATCTCTTTTAACAATTGATAAT
GGCTTTTTCGAAGTGAAAGCCACTGCTGGTGATACACATTTAGGAGGAGAAGACTTTGAT
AACAAGCTAGTAGAGTTTTGTGCATAAGAGTTCTAAAAGAGAAAGTCTATTGATATTAGG
AATAATCCAAGAGCTATGAGAAGACTCAGAACTCAATGTGAAAGAGCAAAAAGAATTTTG
TCTTCTTCTGCTCAAGCAACAATTGAAGTAGATGCTTTAGCTGAATCAGAAGACTTTAAT
TATTCTATCTCTCGTCCAAAATTTGAAGAGTTATGCTTACCCTTATTCTAATAATGTATC
CCACCTGTTGAAAAGGTGTTGAAAGATTCAGGAATATCTAAAAGCTAAGTCCACGAAGTT
GTTTTGGTAGGTGGTTCCAGCCGTATTCCTAAAGTTATAGAAATGATAAAAGATTTCTTT
AATGGTAAAGAACCAAATCGTTCTATCAATCCAGATGAAGCTGTGGCATATGGTGCTGCT
GTATAGGCTGCAATTCTAACTGGTTCTAACTCATCATCTATTTAAGACGTTATTCTAGTA
GATGTTACACCTCTTTCCTTAGGCATAGAGACTTCTGGTTAAGTAATGACAGTTTTGATT
CCTAGAAACACACCAATCCCAACAAAAAAATCATAAGTTTTCTCAACATACGCTGATAAC
CAAACTAGTGTCCTTATATAAGTGTTTGAGGGTGAAAGATAATTAACTAAAGATAACCAC
CTTCTTGGCAAGTTCGGATTGGAGGGAATTTCTCCTGCTCCTAGAGGAGTGCCTAAAATT
GAAGTTTCATTCGATATTGATGAAAATGGTATCTTAAACGTTTCAGCTGTAGACTAAGCT
ACAAGCAAATCTAATAAAATTACTATTACTAACTAAAAAGGAAGATTTAGCTAGGATGAA
ATTGAAAAATTAGTAAAAGAAGCTGAGTAGTATAAAGAATAAGATGAGTAAATCAAGAAA
AAAATAGATGCTAAAAATAGTCTAGAAAATTATACTTATTCAGTAAGAAACTCACTAAAT
GACGAGAAAATCAGAGAGAAAATATCTTAAGAAGATAAGAGATAAGTCTAAAACCTAGTT
GAATCAACTTAAAGATGGATAGAATCAAACTCAGATGCTTCTCCAGAAGAGTACTAAAAT
AAATAAAAGGAACTTGAAAATATATTTAATCCTATTATGATGAAAGTGTATCAACAAAGT
AGTTAAGCAGGACCTAGTGAAAACAATTATTAAAATTCTTAATCATCAAATAATACTCAT
TCTGACGAAGTTGATTGA


>TTHERM_01080440(protein)
MSKNKKAEGVAVGIDLGTTYSCVGVFQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA
KNQTARNPTNTIFDAKRLIGRKFSDPIVQKDIKLWPFKVEAGIDDKPLIVVKFKGETKKF
HAEEISSMVLTKMKETAEAFVSQPVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN
EPTAAAIAYGLDKKQQGEKNILIFDLGGGTFDVSLLTIDNGFFEVKATAGDTHLGGEDFD
NKLVEFCAQEFQKRKSIDIRNNPRAMRRLRTQCERAKRILSSSAQATIEVDALAESEDFN
YSISRPKFEELCLPLFQQCIPPVEKVLKDSGISKSQVHEVVLVGGSSRIPKVIEMIKDFF
NGKEPNRSINPDEAVAYGAAVQAAILTGSNSSSIQDVILVDVTPLSLGIETSGQVMTVLI
PRNTPIPTKKSQVFSTYADNQTSVLIQVFEGERQLTKDNHLLGKFGLEGISPAPRGVPKI
EVSFDIDENGILNVSAVDQATSKSNKITITNQKGRFSQDEIEKLVKEAEQYKEQDEQIKK
KIDAKNSLENYTYSVRNSLNDEKIREKISQEDKRQVQNLVESTQRWIESNSDASPEEYQN
KQKELENIFNPIMMKVYQQSSQAGPSENNYQNSQSSNNTHSDEVD


>TTHERM_01080440(gene)
ATGTCTAAAAACAAAAAAGCTGAAGGAGTTGCTGTCGGTATTGATCTAGGAACTACCTAT
TCTTGTGTAGGTGTTTTTTAAAACGATAGAGTAGAAATAATTGCTAATGACTAAGGAAAT
AGAACAACTCCATCTTATGTTGCTTTCACAGATACTGAGAGACTTATAGGAGATGCTGCT
AAAAACTAAACAGCTAGAAACCCTACAAATACAATATTTGATGCCAAAAGATTGATTGGA
AGAAAATTTAGTGATCCAATAGTTTAAAAAGACATTAAATTATGGCCATTTAAAGTAGAA
GCTGGTATTGATGACAAGCCTTTAATTGTTGTTAAATTTAAAGGAGAAACAAAAAAATTC
CATGCTGAAGAAATATCATCAATGGTTCTTACAAAAATGAAAGAAACAGCAGAAGCATTC
GTTTCCTAACCTGTTAAGAATGCAGTTATTACTGTTCCTGCTTATTTTAATGATTCATAA
AGATAAGCCACAAAAGATGCTGGTGCTATAGCAGGATTAAATGTTCTCAGAATCATAAAT
GAGCCTACTGCTGCAGCTATTGCTTACGGATTAGATAAAAAGTAATAAGGCGAAAAGAAT
ATTTTAATTTTTGATTTGGGTGGAGGTACCTTCGATGTATCTCTTTTAACAATTGATAAT
GGCTTTTTCGAAGTGAAAGCCACTGCTGGTGATACACATTTAGGAGGAGAAGACTTTGAT
AACAAGCTAGTAGAGTTTTGTGCATAAGAGTTCTAAAAGAGAAAGTCTATTGATATTAGG
AATAATCCAAGAGCTATGAGAAGACTCAGAACTCAATGTGAAAGAGCAAAAAGAATTTTG
TCTTCTTCTGCTCAAGCAACAATTGAAGTAGATGCTTTAGCTGAATCAGAAGACTTTAAT
TATTCTATCTCTCGTCCAAAATTTGAAGAGTTATGCTTACCCTTATTCTAATAATGTATC
CCACCTGTTGAAAAGGTGTTGAAAGATTCAGGAATATCTAAAAGCTAAGTCCACGAAGTT
GTTTTGGTAGGTGGTTCCAGCCGTATTCCTAAAGTTATAGAAATGATAAAAGATTTCTTT
AATGGTAAAGAACCAAATCGTTCTATCAATCCAGATGAAGCTGTGGCATATGGTGCTGCT
GTATAGGCTGCAATTCTAACTGGTTCTAACTCATCATCTATTTAAGACGTTATTCTAGTA
GATGTTACACCTCTTTCCTTAGGCATAGAGACTTCTGGTTAAGTAATGACAGTTTTGATT
CCTAGAAACACACCAATCCCAACAAAAAAATCATAAGTTTTCTCAACATACGCTGATAAC
CAAACTAGTGTCCTTATATAAGTGTTTGAGGGTGAAAGATAATTAACTAAAGATAACCAC
CTTCTTGGCAAGTTCGGATTGGAGGGAATTTCTCCTGCTCCTAGAGGAGTGCCTAAAATT
GAAGTTTCATTCGATATTGATGAAAATGGTATCTTAAACGTTTCAGCTGTAGACTAAGCT
ACAAGCAAATCTAATAAAATTACTATTACTAACTAAAAAGGAAGATTTAGCTAGGATGAA
ATTGAAAAATTAGTAAAAGAAGCTGAGTAGTATAAAGAATAAGATGAGTAAATCAAGAAA
AAAATAGATGCTAAAAATAGTCTAGAAAATTATACTTATTCAGTAAGAAACTCACTAAAT
GACGAGAAAATCAGAGAGAAAATATCTTAAGAAGATAAGAGATAAGTCTAAAACCTAGTT
GAATCAACTTAAAGATGGATAGAATCAAACTCAGATGCTTCTCCAGAAGAGTACTAAAAT
AAATAAAAGGAACTTGAAAATATATTTAATCCTATTATGATGAAAGTGTATCAACAAAGT
AGTTAAGCAGGACCTAGTGAAAACAATTATTAAAATTCTTAATCATCAAATAATACTCAT
TCTGACGAAGTTGATTGA