Identifiers and Description

Gene Model Identifier

TTHERM_00125640

Standard Name

SSA3 (HSP70a paralog)

Aliases

PreTt09326 | 9.m00347 | 3699.m00057

Description

dnaK protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF06723 ) MreB/Mbl protein
  • ( PF00012 ) DnaK family protein
  • ( TIGR02350 ) chaperone protein DnaK
  • ( PF01968 ) hydantoinase/oxoprolinase
  • ( PF00249 ) Myb-like DNA-binding domain
  • ( TIGR01174 ) cell division protein FtsA
  • ( TIGR01784 ) conserved hypothetical protein
  • ( TIGR01991 ) Fe-S protein assembly chaperone HscA
  • ( TIGR00904 ) cell shape determining protein, MreB/Mrl
  • ( TIGR02529 ) ethanolamine utilization protein EutJ family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00125640

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_9940
WormBaseWBGene000020059.997093137033517e-262locus:hsp-1 Heat shock 70 kD
a protein A status:Confirmed
UniProt:P09446 protein_id
:CAB02319.1
Tetrahymena borealisEI9_14410.19.997093137033517e-262dnaK protein (651 aa)
DictyBaseDDB_G02691449.997093137033517e-262hspB on chromosome: 1 position
4410084 to 4412006
OxytrichaContig18685.0.g309.997093137033517e-262Hsp70 protein
SGDYBL075C9.997093137033517e-262SSA3 ATPase involved in protei
n folding and the response to
stress; plays a role in SRP-de
pendent cotranslational protei
n-membrane targeting and trans
location; member of the heat s
hock protein 70 (HSP70) family
; localized to the cytoplasm

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:25586926: Fukuda Y, Akematsu T, Attiq R, Tada C, Nakai Y, Pearlman RE (2015) Role of the Cytosolic Heat Shock Protein 70 Ssa5 in the Ciliate Protozoan Tetrahymena thermophila. The Journal of eukaryotic microbiology 62(4):481-93

Sequences

>TTHERM_00125640(coding)
ATGTCTGGAAAATAAAAAGCTGAAGGAATTGGTATTGGTATCGATCTTGGTACTACTTAC
TCTTGTGTAGGTGTCTTCTAAAATGATCGAGTTGAAATTATAGCAAATGATCAAGGTAAT
AGAACTACTCCTTCTTACGTTGCTTTCACTGACACAGAAAGATTAATTGGTGATGCTGCT
AAGAACTAGACAGCCAGAAATCCTACTAACACTATTTTTGATGCAAAGAGACTTATTGGT
AGAAAATTCAGTGACCCAATTGTTCAAAAAGATATCAAATTATGGCCTTTCAAAGTAGAA
TCAGGTCCAGATGACAAGCCATTGATTGTTGTCAAATTCAAGGGCGAAACCAAGAAATTC
CATGCAGAAGAAATTTCTTCAATGGTCTTGACTAAAATGAAAGAAATAGCTGAAGCCTTC
CTTTCAAAAACTGTAAAAAATGCAGTTATTACAGTTCCTGCATACTTCAATGATTCACAA
AGATAAGCTACCAAAGATGCAGGTGCCATTGCTGGCTTAAATGTTTTAAGAATTATCAAT
GAACCTACTGCAGCAGCTATTGCTTATGGCTTGGATAAGAAGGGCTAAGGTGAAAAAAAT
ATCTTGATTTTTGATTTAGGTGGTGGTACTTTTGATGTTTCTCTCTTAACTATCGATGAT
GGTTTCTTCGAAGTCAAAGCTACTGCTGGTGATACTCACTTGGGAGGAGAAGACTTTGAT
AACAAAATGGTCGAATTTTGTGCAGCTGAATTTTAGAAAAAGAAAGGCATTGATATTAAA
AATAATCCTAGAGCCATGAGAAGACTTAGAACTTAATGCGAAAGAGCCAAGAGAATTCTT
TCTTCTTCTGCTTAGGCTACCATAGAAGTTGATGCACTTGCTGAATCAGAAGACTTTAAT
CTCGTTATGTCTCGTCCTAAATTTGAAGAGCTTTGCTTGTCTCTCTTCTAGCAATGCATT
CCTCCAGTTGAGAAAGTATTAAAGGATTCAGGTCTCTCTAAGAGCCAAGTCCATGAAGTT
GTTTTGGTAGGAGGATCTAGCCGTATTCCTAAAGTCATTTAATTAGTAAGTGAGTATTTT
AATGGAAAGGAGCCTAATCGTTCCATCAACCCTGATGAAGCCGTCGCTTATGGTGCAGCA
GTACAAGCTGCCATTTTGACTGGATCAGGCTCAGAAAATATTCAAGATGTAATCTTGGTT
GATGTCACTCCTCTTTCATTAGGTATTGAAACTTCTGGATAAGTTATGACTGTTCTCATC
CCTAGAAATACAACTATTCCTACCAAAAAATCATAAATTTTCACTACTTATGCAGACAAT
CAGACCAGTGTACTTATTTAAGTATTTGAGGGTGAGAGATAGCTTACTAAAGATAACCAT
TTACTCGGTAAATTCGGTTTAGAAGGAATAGCCCCAGCTCCTAGAGGAGTTCCTTAAATT
GAAGTATCATTTGATATTGATGAAAATGGTATCTTGAATGTAACTGCAGTAGATAAGGCT
TCTAATAAGAGTAACAAAATTACAATTACTAATCAAAAGGGAAGATTCAGCTAATCAGAA
ATAGATAGACTTGTCAGAGAAGCTGAATAATACAAGGCTGAGGATGAAAAAGTAAAACAA
AAAATTGAAGCCAAAAATGGCCTTGAAAATTATACCTACTCCATCCGTAATTCAATGAAT
GATGAAAAATTAAAAGATAAATTTTCTTCAGATGAAAAAACTAGACTCCAAAACTTAATA
GACTCTACCCAAAAGTGGTTAGAATCTCATCCTAACGAAAATGCCGATGCTTACAAGAAC
AAGCAAAAGGAAATAGAAGATGTGTTCAACCCCATCATGATGAGAGTTTATCAATAAACT
GGTGCTGCTCCAGGTGATTTCGGAAAAACTTCATCCAACACTGCTACCAACAATGCTTCT
AATGTTGATGAAGTTGATTGA


>TTHERM_00125640(protein)
MSGKQKAEGIGIGIDLGTTYSCVGVFQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA
KNQTARNPTNTIFDAKRLIGRKFSDPIVQKDIKLWPFKVESGPDDKPLIVVKFKGETKKF
HAEEISSMVLTKMKEIAEAFLSKTVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN
EPTAAAIAYGLDKKGQGEKNILIFDLGGGTFDVSLLTIDDGFFEVKATAGDTHLGGEDFD
NKMVEFCAAEFQKKKGIDIKNNPRAMRRLRTQCERAKRILSSSAQATIEVDALAESEDFN
LVMSRPKFEELCLSLFQQCIPPVEKVLKDSGLSKSQVHEVVLVGGSSRIPKVIQLVSEYF
NGKEPNRSINPDEAVAYGAAVQAAILTGSGSENIQDVILVDVTPLSLGIETSGQVMTVLI
PRNTTIPTKKSQIFTTYADNQTSVLIQVFEGERQLTKDNHLLGKFGLEGIAPAPRGVPQI
EVSFDIDENGILNVTAVDKASNKSNKITITNQKGRFSQSEIDRLVREAEQYKAEDEKVKQ
KIEAKNGLENYTYSIRNSMNDEKLKDKFSSDEKTRLQNLIDSTQKWLESHPNENADAYKN
KQKEIEDVFNPIMMRVYQQTGAAPGDFGKTSSNTATNNASNVDEVD


>TTHERM_00125640(gene)
ATGTCTGGAAAATAAAAAGCTGAAGGAATTGGTATTGGTATCGATCTTGGTACTACTTAC
TCTTGTGTAGGTGTCTTCTAAAATGATCGAGTTGAAATTATAGCAAATGATCAAGGTAAT
AGAACTACTCCTTCTTACGTTGCTTTCACTGACACAGAAAGATTAATTGGTGATGCTGCT
AAGAACTAGACAGCCAGAAATCCTACTAACACTATTTTTGATGCAAAGAGACTTATTGGT
AGAAAATTCAGTGACCCAATTGTTCAAAAAGATATCAAATTATGGCCTTTCAAAGTAGAA
TCAGGTCCAGATGACAAGCCATTGATTGTTGTCAAATTCAAGGGCGAAACCAAGAAATTC
CATGCAGAAGAAATTTCTTCAATGGTCTTGACTAAAATGAAAGAAATAGCTGAAGCCTTC
CTTTCAAAAACTGTAAAAAATGCAGTTATTACAGTTCCTGCATACTTCAATGATTCACAA
AGATAAGCTACCAAAGATGCAGGTGCCATTGCTGGCTTAAATGTTTTAAGAATTATCAAT
GAACCTACTGCAGCAGCTATTGCTTATGGCTTGGATAAGAAGGGCTAAGGTGAAAAAAAT
ATCTTGATTTTTGATTTAGGTGGTGGTACTTTTGATGTTTCTCTCTTAACTATCGATGAT
GGTTTCTTCGAAGTCAAAGCTACTGCTGGTGATACTCACTTGGGAGGAGAAGACTTTGAT
AACAAAATGGTCGAATTTTGTGCAGCTGAATTTTAGAAAAAGAAAGGCATTGATATTAAA
AATAATCCTAGAGCCATGAGAAGACTTAGAACTTAATGCGAAAGAGCCAAGAGAATTCTT
TCTTCTTCTGCTTAGGCTACCATAGAAGTTGATGCACTTGCTGAATCAGAAGACTTTAAT
CTCGTTATGTCTCGTCCTAAATTTGAAGAGCTTTGCTTGTCTCTCTTCTAGCAATGCATT
CCTCCAGTTGAGAAAGTATTAAAGGATTCAGGTCTCTCTAAGAGCCAAGTCCATGAAGTT
GTTTTGGTAGGAGGATCTAGCCGTATTCCTAAAGTCATTTAATTAGTAAGTGAGTATTTT
AATGGAAAGGAGCCTAATCGTTCCATCAACCCTGATGAAGCCGTCGCTTATGGTGCAGCA
GTACAAGCTGCCATTTTGACTGGATCAGGCTCAGAAAATATTCAAGATGTAATCTTGGTT
GATGTCACTCCTCTTTCATTAGGTATTGAAACTTCTGGATAAGTTATGACTGTTCTCATC
CCTAGAAATACAACTATTCCTACCAAAAAATCATAAATTTTCACTACTTATGCAGACAAT
CAGACCAGTGTACTTATTTAAGTATTTGAGGGTGAGAGATAGCTTACTAAAGATAACCAT
TTACTCGGTAAATTCGGTTTAGAAGGAATAGCCCCAGCTCCTAGAGGAGTTCCTTAAATT
GAAGTATCATTTGATATTGATGAAAATGGTATCTTGAATGTAACTGCAGTAGATAAGGCT
TCTAATAAGAGTAACAAAATTACAATTACTAATCAAAAGGGAAGATTCAGCTAATCAGAA
ATAGATAGACTTGTCAGAGAAGCTGAATAATACAAGGCTGAGGATGAAAAAGTAAAACAA
AAAATTGAAGCCAAAAATGGCCTTGAAAATTATACCTACTCCATCCGTAATTCAATGAAT
GATGAAAAATTAAAAGATAAATTTTCTTCAGATGAAAAAACTAGACTCCAAAACTTAATA
GACTCTACCCAAAAGTGGTTAGAATCTCATCCTAACGAAAATGCCGATGCTTACAAGAAC
AAGCAAAAGGAAATAGAAGATGTGTTCAACCCCATCATGATGAGAGTTTATCAATAAACT
GGTGCTGCTCCAGGTGATTTCGGAAAAACTTCATCCAACACTGCTACCAACAATGCTTCT
AATGTTGATGAAGTTGATTGA