Identifiers and Description

Gene Model Identifier

TTHERM_00001420

Standard Name

SRVW1 (Starvation-response von Willebrand Factor)

Aliases

PreTt11549 | 1.m00597

Description

von Willebrand factor type A domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00092 ) von Willebrand factor type A

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00001420

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19256.19.997093137033517e-262von Willebrand factor type A d
omain-containing protein (598
aa)
Stentor CoeruleusSteCoe_256582.8625185805493937e-20
OxytrichaContig9219.0.g290.000030009396760408108von Willebrand factor type A d
omain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00001420(coding)
ATGGATAAAGATAATATTAACATTATTAACTCAATAACTAAACCATAGAAGAAGTTATCA
GTTTCAAATAAAACAGAAGCCAAAAAGATTTCTCAACCCTCTACTTTGGCTAAAAAAACT
ACATCAAACACTTCTAAAAATCTTTCTAACTAAGTCAAGACTTCTCCAGAAGTTCAATAA
TTGATTTCTTAAGTAATTAAATAAGCATCTTTAAAGCCAAAGTCAGTTGCTGTTTAAAAA
TAATCTTTAGCCTAAAACCCTATTAAAGCGAAAGCTACATAGCTTAAATCTGCAGTTTCA
AAATAACTTACTTCATTTTAAAAATCTGATATCTCTATTCAAAAGGAAGAAAAAATATAA
AAGCTAGATACCAAAACTATGCTTCGAGAGTAAGAAATTAAACCTGACTTATAACAAATG
ATTAAAGATGCTAAAAAACCATCTTATGATTTGGAAAAAGGTTTAACATTTGAAATCAAA
ACTCTTAACAAGCATTTCTAATTCAATAATGAATAAGATTGCAATATTCCTATCATGGTC
TCAGTTAAGACTTAAGATTCTACTAACGATATTTTAGAAGAGTAAAAGGAATAGGTAAAA
TAAGCAGAATAGTCAAGACCAAGCATAGATTTAGTTTGTGTTATTGATAATTCAGGATCT
ATGTAAGGAGAAAAGATTTAAAATGTTAAAACAACACTTCTTTAACTACTTGATATGTTA
AATTCTAACGATAGATTATCATTAATTCTATTCAATTCTTATCCTACTCTTTTATGTAAC
TTAAGAAAAGTTGATGATAAGAATACACCAAATATTTAGAAAATTATCAATTCTATAACT
GCTGAAGAATACACAGACATCAATAGTGGTATGCTCATGGCTTTTAATATTTTGTAAAAG
AGACAATTTTTCAACCCAGTTAGTTCTATTTTCTTGCTTTCTGATGGCCAAGATAATGGA
GCTGATGAAAAAATTAAAAAATATATCAATTCAAATCAATCATTGAAAAATGAATGCTTT
TCTATTCACTCATTTGGATTTGGTTCTGATCATGATGGCCCCTTAATGAATAGAATTTGC
TAATTAAAGGATGGTAACTTTTATTATGTTGAAAAAATTAATCAAGTTGATGAATTCTTT
GTAGATGCTCTTGGAGGACTTTTCTCTGTTGTTGCTCAAGAAATCTTAATAGAAATTAAC
CTAAACAGATAAGATAAAAATTTCTAAAAATATTTCTCAAATTGTAAAGTATCTAAAACA
TATGGAGATATGTGGAAATGTATCAAATAAGATGAGATCTATCAAATAAAAATTAATTAG
CTGTTTTCAGGAGTTTCTAAAGACTTTATTATGGAAATAGTTGTTCCGAAATAAGAAGTA
AAGATGTTAGAAGATTTTGAGAGAAATTTAGAGATAGTCAAAGGTTAGCTAACTGCTATT
CCAGTCGACATACAATACACAACAAAAATAGTGAAAGATAGCAACCTAATTTTAACTTTG
TTTTTGTAAAACGAAACTGTTCCAGTAGATTCAGAAATTAATGATGCTGTAGAATTCAAC
TATCTTAGAGTTTAAGCAGCTGAGGCTATGGAAGTAGCTATTAGTTATAGTGAAAAGTAG
TAATACGAATAAAGCTAAGTTGTATTAAAAAGTATTCTGAGCAAAATAGAGAATTCTCAT
CCCAAAAACAAATAAAAAATTTTAATTCTTAAAAAAGATCTTCTTGATTGCTAAGAGAGT
GCCTAGCCAAGAGTTTATGAGAATGTAGGTAAATATAAAATGTTAAGCAAAAAAGTAGCA
AACTCTAAGTAGGCTTCATAAGCTGTGGAAGAATGTGATATGTACTAAAACAATATTTAA
AAAGTAATGGTTATGTGTATAAAAAAAAAGAAGATGTGA


>TTHERM_00001420(protein)
MDKDNINIINSITKPQKKLSVSNKTEAKKISQPSTLAKKTTSNTSKNLSNQVKTSPEVQQ
LISQVIKQASLKPKSVAVQKQSLAQNPIKAKATQLKSAVSKQLTSFQKSDISIQKEEKIQ
KLDTKTMLREQEIKPDLQQMIKDAKKPSYDLEKGLTFEIKTLNKHFQFNNEQDCNIPIMV
SVKTQDSTNDILEEQKEQVKQAEQSRPSIDLVCVIDNSGSMQGEKIQNVKTTLLQLLDML
NSNDRLSLILFNSYPTLLCNLRKVDDKNTPNIQKIINSITAEEYTDINSGMLMAFNILQK
RQFFNPVSSIFLLSDGQDNGADEKIKKYINSNQSLKNECFSIHSFGFGSDHDGPLMNRIC
QLKDGNFYYVEKINQVDEFFVDALGGLFSVVAQEILIEINLNRQDKNFQKYFSNCKVSKT
YGDMWKCIKQDEIYQIKINQLFSGVSKDFIMEIVVPKQEVKMLEDFERNLEIVKGQLTAI
PVDIQYTTKIVKDSNLILTLFLQNETVPVDSEINDAVEFNYLRVQAAEAMEVAISYSEKQ
QYEQSQVVLKSILSKIENSHPKNKQKILILKKDLLDCQESAQPRVYENVGKYKMLSKKVA
NSKQASQAVEECDMYQNNIQKVMVMCIKKKKM


>TTHERM_00001420(gene)
ATGGATAAAGATAATATTAACATTATTAACTCAATAACTAAACCATAGAAGAAGTTATCA
GTTTCAAATAAAACAGAAGCCAAAAAGATTTCTCAACCCTCTACTTTGGCTAAAAAAACT
ACATCAAACACTTCTAAAAATCTTTCTAACTAAGTCAAGACTTCTCCAGAAGTTCAATAA
TTGATTTCTTAAGTAATTAAATAAGCATCTTTAAAGCCAAAGTCAGTTGCTGTTTAAAAA
TAATCTTTAGCCTAAAACCCTATTAAAGCGAAAGCTACATAGCTTAAATCTGCAGTTTCA
AAATAACTTACTTCATTTTAAAAATCTGATATCTCTATTCAAAAGGAAGAAAAAATATAA
AAGCTAGATACCAAAACTATGCTTCGAGAGTAAGAAATTAAACCTGACTTATAACAAATG
ATTAAAGATGCTAAAAAACCATCTTATGATTTGGAAAAAGGTTTAACATTTGAAATCAAA
ACTCTTAACAAGCATTTCTAATTCAATAATGAATAAGATTGCAATATTCCTATCATGGTC
TCAGTTAAGACTTAAGATTCTACTAACGATATTTTAGAAGAGTAAAAGGAATAGGTAAAA
TAAGCAGAATAGTCAAGACCAAGCATAGATTTAGTTTGTGTTATTGATAATTCAGGATCT
ATGTAAGGAGAAAAGATTTAAAATGTTAAAACAACACTTCTTTAACTACTTGATATGTTA
AATTCTAACGATAGATTATCATTAATTCTATTCAATTCTTATCCTACTCTTTTATGTAAC
TTAAGAAAAGTTGATGATAAGAATACACCAAATATTTAGAAAATTATCAATTCTATAACT
GCTGAAGAATACACAGACATCAATAGTGGTATGCTCATGGCTTTTAATATTTTGTAAAAG
AGACAATTTTTCAACCCAGTTAGTTCTATTTTCTTGCTTTCTGATGGCCAAGATAATGGA
GCTGATGAAAAAATTAAAAAATATATCAATTCAAATCAATCATTGAAAAATGAATGCTTT
TCTATTCACTCATTTGGATTTGGTTCTGATCATGATGGCCCCTTAATGAATAGAATTTGC
TAATTAAAGGATGGTAACTTTTATTATGTTGAAAAAATTAATCAAGTTGATGAATTCTTT
GTAGATGCTCTTGGAGGACTTTTCTCTGTTGTTGCTCAAGAAATCTTAATAGAAATTAAC
CTAAACAGATAAGATAAAAATTTCTAAAAATATTTCTCAAATTGTAAAGTATCTAAAACA
TATGGAGATATGTGGAAATGTATCAAATAAGATGAGATCTATCAAATAAAAATTAATTAG
CTGTTTTCAGGAGTTTCTAAAGACTTTATTATGGAAATAGTTGTTCCGAAATAAGAAGTA
AAGATGTTAGAAGATTTTGAGAGAAATTTAGAGATAGTCAAAGGTTAGCTAACTGCTATT
CCAGTCGACATACAATACACAACAAAAATAGTGAAAGATAGCAACCTAATTTTAACTTTG
TTTTTGTAAAACGAAACTGTTCCAGTAGATTCAGAAATTAATGATGCTGTAGAATTCAAC
TATCTTAGAGTTTAAGCAGCTGAGGCTATGGAAGTAGCTATTAGTTATAGTGAAAAGTAG
TAATACGAATAAAGCTAAGTTGTATTAAAAAGTATTCTGAGCAAAATAGAGAATTCTCAT
CCCAAAAACAAATAAAAAATTTTAATTCTTAAAAAAGATCTTCTTGATTGCTAAGAGAGT
GCCTAGCCAAGAGTTTATGAGAATGTAGGTAAATATAAAATGTTAAGCAAAAAAGTAGCA
AACTCTAAGTAGGCTTCATAAGCTGTGGAAGAATGTGATATGTACTAAAACAATATTTAA
AAAGTAATGGTTATGTGTATAAAAAAAAAGAAGATGTGA