Identifiers and Description

Gene Model Identifier

TTHERM_00114360

Standard Name

SRS1 (seryl-tRNA synthetase 1)

Aliases

PreTt27151 | 8.m00411 | 3812.m02444

Description

seryl-tRNA synthetase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00114360

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03895.19.997093137033517e-262seryl-tRNA synthetase (511 aa)
DictyBaseDDB_G02726607.999428951178753e-163serS on chromosome: 2 position
2243539 to 2245192
OxytrichaContig1296.0.g129.998596099208102e-158tRNA synthetase class II core
domain (G, H, P, S and T)
SGDYDR023W1.9994249217050915e-157SES1 Cytosolic seryl-tRNA synt
hetase, class II aminoacyl-tRN
A synthetase that aminoacylate
s tRNA(Ser), displays tRNA-dep
endent amino acid recognition
which enhances discrimination
of the serine substrate, inter
acts with peroxin Pex21p
WormBaseWBGene000056637.997133821356313e-142locus:sars-1 Probable serine
--tRNA ligase, cytoplasmic s
tatus:Confirmed UniProt:Q186
78 protein_id:CAA93105.1
Stentor CoeruleusSteCoe_3682.001470128041443e-75

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00114360(coding)
ATGCTGGCTTTAAGAAGATTGAACAATTTTCAAAAATTATATAAATTTAATAAAAATATA
AATATTTTACCTTTTTAAAAAACCAATTACTATAACAATCTAAATTTCAAACTTACTTAT
TAAATGGGTCTTGACATTAACGACTTCAGAAAGGAAAAGGGTGGTGATCCCGAAAAGATT
AAGGAATCTCAAAGAAGAAGATACGCAAAAGTTGAATTAGTTGACGAAGTCGTTGCATTA
GACGAAGAATGGAGAAAGTCCTAATATAACTACGAACAAGCCAGAAAGGAATTGAGAATT
GTTCAAACTGCTATCGGTGAGAGAAAGAAGAAAGATAAGACTGATGCTTGTGAAGATCTC
CTTGCTGAAAAAGCTAAAATCGAAGAAAAGATCAAGGCTTTAGAAGTTGAAAGCAGTGAA
AAGAAAGAAAAGTTAGAAGTTACTTTGAAGAAGATTGGTAACATCGTTCATGACTCTGTC
GTTGTTCACAACAACGAAGACTTCAACGGAGTTGTTAGAACTTGGGGTGATGATATCAAG
AGAGTTATTAAGATTGACGAAACTCCTGGTGCTGCTCACCACCATCAAATTCTCTACATG
CTCGATGGCTTCGACCAAAAGAGAGGTTAAAAGATTGCTGGTCACAGAGGTTATTTCTTA
AAGAACTACGGTGTTCTTTTAGTTCAAGCTTTATGTACTTTCGGTTAATAATTCTTAATG
AAGAAGGGTTACTGCCCTATGTACACTCCTTTCTTCATGAAGAAGGATGTTATGGGTGAA
ACTTGCTAATTGTCTGACTTTGATGAACAACTTTACAAGGTTGACTCCACCAGTGTCATG
CATGCTGAAGAATAAAAGACCTTAAACGAAGATAAGGAAAAATACTTGATTGCCACTTCT
GAACAACCCATTTCTGCCTTCCATTCTGGTGAATGGATTGATTCTAAGGAACTTCCCTTA
AGATATGCTGGTCTTTCCACTTGCTTCAGAAAGGAAGCTGGTGCTGCTGGAAGAGAAACC
TGGGGTGTCTACAGAGTCCACTAATTCGAAAAGGTCGAATAATTCGTTCTCTGCAAGCCT
GAAGACTCTTGGGATGAACTCGAAAGAATGATTAAAATTTCTGAAGAATTCATGTAAGAA
CTCGGCTTACCCTACAGAGTTGTTAATATCGTCTCTGGTGCTCTTAATGATGCTGCTGCT
AAAAAGTACGATCTTGAAGCTTGGTTCCCCGGTTATGGTCAATACAAGGAATTGGTTTCT
TGCTCTAACTGTACTGACTTCTAATCCAGAGGTTTGAACGTCACTACCGGTGAAGTCATT
CCTGGTAAGAAGGACGGTGATAAGGGTAATGAAAAGAAGTTCGTTCACATGCTTAATGGT
ACTTTATGTGCTGCTTAAAGAACCTTAACTTGTATTTTAGAAAATTATCAAGAAAAGGAC
GGTGTTCGTGTTCCTAAATGCCTCGTTCCCTTTGTTGGTACTGATTTCCTTCCTTACAAG
TTACCTATGCCCAAAAAGACTGAATTCTAATGA


>TTHERM_00114360(protein)
MLALRRLNNFQKLYKFNKNINILPFQKTNYYNNLNFKLTYQMGLDINDFRKEKGGDPEKI
KESQRRRYAKVELVDEVVALDEEWRKSQYNYEQARKELRIVQTAIGERKKKDKTDACEDL
LAEKAKIEEKIKALEVESSEKKEKLEVTLKKIGNIVHDSVVVHNNEDFNGVVRTWGDDIK
RVIKIDETPGAAHHHQILYMLDGFDQKRGQKIAGHRGYFLKNYGVLLVQALCTFGQQFLM
KKGYCPMYTPFFMKKDVMGETCQLSDFDEQLYKVDSTSVMHAEEQKTLNEDKEKYLIATS
EQPISAFHSGEWIDSKELPLRYAGLSTCFRKEAGAAGRETWGVYRVHQFEKVEQFVLCKP
EDSWDELERMIKISEEFMQELGLPYRVVNIVSGALNDAAAKKYDLEAWFPGYGQYKELVS
CSNCTDFQSRGLNVTTGEVIPGKKDGDKGNEKKFVHMLNGTLCAAQRTLTCILENYQEKD
GVRVPKCLVPFVGTDFLPYKLPMPKKTEFQ


>TTHERM_00114360(gene)
CAAATTTCCCCAAACGAATCATGCTGGCTTTAAGAAGATTGAACAATTTTCAAAAATTAT
ATAAATTTAATAAAAATATAAATATTTTACCTTTTTAAAAAACCAATTACTATAACAATC
TAAATTTCAAACTTACTTATTAAATGGGTCTTGACATTAACGACTTCAGAAAGGAAAAGG
GTAAATAGCTTTGTTTTCTTCACATCATACTATTCTTGTTTTAGAGCAAACTCTCTATTT
TAAAAATATTTTCTTAATTGAAGCGATCACTAAATATCTATACATAAAACAATCAACCTT
AATTAATTATTTGAATTTATCTATTTTTTTCAAATATTATAGGTGGTGATCCCGAAAAGA
TTAAGGAATCTCAAAGAAGAAGATACGCAAAAGTTGAATTAGTTGACGAAGTCGTTGCAT
TAGACGAAGAATGGAGAAAGTGTAAGCATTCTTTAAATTTTATTAATTACTTACTTTACC
AAGAACGAAATGGCTAACTACCCATTCGAAAGTGCCAAAAAAGCAAGAAGTTATATACAA
ATTAAACTAAAGGAAAAAATGTTTGAATAGCCATTAGAAAAATTAAGTCTGATGATGATT
TAAATAATTAGATTTTAGTTAATGCTCTCATTATTCAAAATTTATCTTAATTTAAAACAG
CCTAATATAACTACGAACAAGCCAGAAAGGAATTGAGAATTGTTCAAACTGCTATCGGTG
AGAGAAAGAAGAAAGATAAGACTGATGCTTGTGAAGATCTCCTTGCTGAAAAAGCTAAAA
TCGAAGAAAAGATCAAGGCTTTAGAAGTTGAAAGCAGTGAAAAGAAAGAAAAGTTAGAAG
TTACTTTGAAGAAGATTGGTAACATCGTTCATGACTCTGTCGTTGTTCACAACAACGAAG
ACTTCAACGGAGTTGTTAGAACTTGGGGTGATGATATCAAGAGAGTTATTAAGATTGACG
AAACTCCTGGTGCTGCTCACCACCATCAAATTCTCTACATGCTCGATGGCTTCGACCAAA
AGAGAGGTAAAATGATATTATCTTATTTATACAGATCTAAAAAAATAGATACATAGAACC
AATCAATATCTTTCTTTAGTTTTCCTTTTCTTTGTTACCAAAATCTTAAATAGAATCAAA
TAGCGTCTATGCATAAATGAATGAATGAATAAATAAATGTACAAAGCATAAAAAAGATTA
AAAGGAGAAGTTTGCAAAAAAAAAGAAAATTATTTAAAAATAGCATTTGTTTCCATCAAT
CTAACTATCTAAAAAGAAAATAAATAAATAAATATCTTCTTTTATTTTTTTAGATTTAGA
AAATATTGAAAATTTTCAGAAGATAAGCGAAAATTCCTTAAAATAAAAAAACGAACAAAG
GATTATTAAAGAAAAATTGACTTTTATCAATATTTTAATTATTCTAATTCTTTTTAAATT
ATTTACGAAAAGGTTAAAAGATTGCTGGTCACAGAGGTTATTTCTTAAAGAACTACGGTG
TTCTTTTAGTTCAAGCTTTATGTACTTTCGGTTAATAATTCTTAATGAAGAAGGGTTACT
GCCCTATGTACACTCCTTTCTTCATGAAGAAGGATGTTATGGGTGAAACTTGCTAATTGT
CTGACTTTGATGAACAACTTTACAAGGTAATTAGCAAAAATAGAATTATTAATGAAATCT
TTTCTTCAAAGCATTTATTTGAAAAAAATTAAATAAATCAGGCAGTTAAATATTAATTGG
TTTTATTAACACAAAAAAAAAATAGGTTGACTCCACCAGTGTCATGCATGCTGAAGAATA
AAAGACCTTAAACGAAGATAAGGAAAAATACTTGATTGCCACTTCTGAACAACCCATTTC
TGCCTTCCATTCTGGTGAATGGATTGATTCTAAGGAACTTCCCTTAAGATATGCTGGTCT
TTCCACTTGCTTCAGAAAGGAAGCTGGTGCTGCTGGAAGAGAAACCTGGGGTGTCTACAG
AGTCCACTAATTCGAAAAGGTCGAATAATTCGTTCTCTGCAAGCCTGAAGACTCTTGGGA
TGAACTCGAAAGAATGATTAAAATTTCTGAAGAATTCATGTAAGAACTCGGCTTACCCTA
CAGAGTTGTTAATATCGTCTCTGGTGCTCTTAATGATGCTGCTGCTAAAAAGTACGATCT
TGAAGCTTGGTTCCCCGGTTATGGTCAATACAAGGTAAATTCAAATACTTGAAAAAATGA
ATCTTTATAAAAATTATAATTAATTTAAAAGGAATTGGTTTCTTGCTCTAACTGTACTGA
CTTCTAATCCAGAGGTTTGAACGTCACTACCGGTGAAGTCATTCCTGGTAAGAAGGACGG
TGATAAGGGTAATGAAAAGAAGTTCGTTCACATGCTTAATGGTACTTTATGTGCTGCTTA
AAGAACCTTAACTTGTATTTTAGAAAATTATCAAGAAAAGGACGGTGTTCGTGTTCCTAA
ATGCCTCGTAATCATCAATTTTTTTTTTTAATTTAATTTTAATTTTACTTTAAATCTTAA
TAGGTTCCCTTTGTTGGTACTGATTTCCTTCCTTACAAGTTACCTATGCCCAAAAAGACT
GAATTCTAATGATTAAACTAAAAATAAAAACTCAACCACTTTTATTATTTGTATCTATCT
ATCTTTCTATGTATTTTTAGTAAAATATTTTTTATTATTACTTAAAAATATTTAATTCTT
TC