Identifiers and Description

Gene Model Identifier

TTHERM_00382150

Standard Name

SQS1 (Squalene synthase)

Aliases

PreTt10372 | 40.m00257

Description

Putative squalene and phytoene synthase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00494 ) Squalene and phytoene synthases
  • ( TIGR01559 ) farnesyl-diphosphate farnesyltransferase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00382150

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00055.19.997093137033517e-262squalene and phytoene synthase
family protein (334 aa)
SGDYHR190W0.0000000000019997478866288316ERG9 Farnesyl-diphosphate farn
esyl transferase (squalene syn
thase), joins two farnesyl pyr
ophosphate moieties to form sq
ualene in the sterol biosynthe
sis pathway
DictyBaseDDB_G02920720.000000000040005666873964816fdfT on chromosome: 6 position
1153510 to 1154993

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00382150(coding)
ATGGCTAGCGTTCAAAAATACACCAAGAGTCCTATGGATATATTGAAAGAAACATCACGT
ACATTCTATATTCCTATTGTCAAGCTTGTTCAAGGAGTCTAAGAGGCTGTTGCTTCTGCT
TACTTGTGCCTCCGTGCTATCGATGAAATCGAAGACCACCCCAATATCCCTAATGAAGTT
AAGGCTCGTATGCTCCGTGAAGTTTCCTTAGTTTGCACTACTTATTCCGCAGAATCTACA
GCTGAATCTCTTACTCCTACTTATGATAATGAAAAGGAATACCGTGATCGTCTTCCTGAA
GTCTCTGCTCGTATTGGAGAATGGATAATGTACTCACCTGCTTCCATCCGTGGTCGTATT
GTTGATGCTACCTCTGGCATGGCTGACAGAATGGCTACCTGGGCTGAACGCAACTGGAAA
TGCGAAACTGAAAGAGATTTAGATGCATACACCTTTGCAGTAGCAGGAGCAGTTGGTTTA
TTGCTTAGCGACATCTGGGCTTGGTGGGATGGCACTAAAACTGATAGAGATCTCGCTATA
GGATTTGGTAGAGGTTTACAAAGCGTTAACATCTTGAGAAATAAGGACGAAGACGCTGAA
CGTGGAGTAACTTTCTATCCCAAGGGCTGGACTGTTGATGACATGCAAGCTTATGCTTAA
AGAAATCTTTAATTTGCTACTAAATACATAAAAGACTTAAAGCCTGGCTCTCCAGCTTTG
ATATTCTGTAGAATTCCTTACAATTTAGCTGTAGCTACTTGCAATACCTTAAAGAGTGGC
AAGGAAAAACTTTCTCGTGAAGAAGTCGTAAAAATTTGCGAAAAAACCGAATTAATTCCT
ACTAACAGCAATGATGGTGCTTCCAAGTAAATTTCTTTGAACGAATTAGATAATGAAAGC
AACAGCACTACTTCCGAAGATAAATCTCCTAAAAACAATTCAAGCATCGAAATAAATTAA
AAAGAATTACCCTAAACCTTAGAACAAGCTGCTTAGTGA


>TTHERM_00382150(protein)
MASVQKYTKSPMDILKETSRTFYIPIVKLVQGVQEAVASAYLCLRAIDEIEDHPNIPNEV
KARMLREVSLVCTTYSAESTAESLTPTYDNEKEYRDRLPEVSARIGEWIMYSPASIRGRI
VDATSGMADRMATWAERNWKCETERDLDAYTFAVAGAVGLLLSDIWAWWDGTKTDRDLAI
GFGRGLQSVNILRNKDEDAERGVTFYPKGWTVDDMQAYAQRNLQFATKYIKDLKPGSPAL
IFCRIPYNLAVATCNTLKSGKEKLSREEVVKICEKTELIPTNSNDGASKQISLNELDNES
NSTTSEDKSPKNNSSIEINQKELPQTLEQAAQ


>TTHERM_00382150(gene)
ATGGCTAGCGTTCAAAAATACACCAAGAGTCCTATGGATATATTGAAAGAAACATCACGT
ACATTCTATATTCCTATTGTCAAGCTTGTTCAAGGAGTCTAAGAGGCTGTTGCTTCTGCT
TACTTGTGCCTCCGTGCTATCGATGAAATCGAAGACCACCCCAATATCCCTAATGAAGTT
AAGGCTCGTATGCTCCGTGAAGTTTCCTTAGTTTGCACTACTTATTCCGCAGAATCTACA
GCTGAATCTCTTACTCCTACTTATGATAATGAAAAGGAATACCGTGATCGTCTTCCTGAA
GTCTCTGCTCGTATTGGAGAATGGATAATGTACTCACCTGCTTCCATCCGTGGTCGTATT
GTTGATGCTACCTCTGGCATGGCTGACAGAATGGCTACCTGGGCTGAACGCAACTGGAAA
TGCGAAACTGAAAGAGATTTAGATGCATACACCTTTGCAGTAGCAGGAGCAGTTGGTTTA
TTGCTTAGCGACATCTGGGCTTGGTGGGATGGCACTAAAACTGATAGAGATCTCGCTATA
GGATTTGGTAGAGGTTTACAAAGCGTTAACATCTTGAGAAATAAGGACGAAGACGCTGAA
CGTGGAGTAACTTTCTATCCCAAGGGCTGGACTGTTGATGACATGCAAGCTTATGCTTAA
AGAAATCTTTAATTTGCTACTAAATACATAAAAGACTTAAAGCCTGGCTCTCCAGCTTTG
ATATTCTGTAGAATTCCTTACAATTTAGCTGTAGCTACTTGCAATACCTTAAAGAGTGGC
AAGGAAAAACTTTCTCGTGAAGAAGTCGTAAAAATTTGCGAAAAAACCGAATTAATTCCT
ACTAACAGCAATGATGGTGCTTCCAAGTAAATTTCTTTGAACGAATTAGATAATGAAAGC
AACAGCACTACTTCCGAAGATAAATCTCCTAAAAACAATTCAAGCATCGAAATAAATTAA
AAAGAATTACCCTAAACCTTAGAACAAGCTGCTTAGTGA