Identifiers and Description

Gene Model Identifier

TTHERM_01093550

Standard Name

SPT6 (SuPressor of Tys)

Aliases

PreTt16928 | 230.m00037 | 3806.m00218

Description

Zinc knuckle family protein; homolog of SPT6 in S. cerevisiae; contains SH2 phosphorylated tyrosine binding pocket; transcription elongation factor; H3-H4 chaperone

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11%

TetraMine Data

TTHERM_01093550

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20570.19.997093137033517e-262zinc knuckle family protein (1
499 aa)
OxytrichaContig16618.0.1.g582.999467474389571e-105Zinc knuckle
DictyBaseDDB_G02723541.0001478224244938e-84spt6 on chromosome: 2 position
1271354 to 1276784
SGDYGR116W1.0004249259458435e-52SPT6 Transcription elongation
factor required for the mainte
nance of chromatin structure d
uring transcription in order t
o inhibit transcription from p
romoters within the coding reg
ion
Stentor CoeruleusSteCoe_113399.221146422925876e-47
WormBaseWBGene000012594.9986056260133516e-43locus:emb-5 Suppressor of Ty
6 homolog status:Confirmed
UniProt:P34703 protein_id:
CAA84737.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000041

Sequences

>TTHERM_01093550(coding)
ATGAGTAAACCAAGAAAAAACGAAGAAGTTGATGATTAAATGAGAAATATTGGAGACGAA
GAAGAAGAAGATTATTAAGGGCAAGTAGAAGAAGAGGAAGATGGCAACAATCAAGTAGAA
GAGGATGATGAGGAAGAAGAAGACGATGATGAATAGGATGATTATCAATAGGATGGATTC
GTCGTTGGAGACTCTGAAGAGGAAGAAATTGAGGAAGAAGAGGATGAAGATGCCGAAGAA
AGACGTCGTCGCAAGAAAGAAAAGAAAAGATAAAAAAAATTGGAAAAATAAAATTAACAC
AGGCGTATCCTCAAGAAAGGACCTAAGAAGAGAGAACTATCAGAAGATGAAATGGAAAAT
AATGAGATATAAGATCTTGAGGAGTATCATGAAGATTCAGAAGAAGGTATTCCTGATAGA
AAGAGAAATCAGTAAAGTAGAACCGGTAATGATGGTCATTAAGGAGACAAGATGGATTTA
GAAGATTAAGGTAATGAAGATTACTTAGAAGATGTAGGTGATTATGGCGCAAAGTATGGA
AAAACAGCCTTTGAAGAACTTTTCATGGACGATGAGTCAGGAGAAGAAGAGCAAAATGAA
AACGAAGATGATGAAAATAGAGAAGTTGATGATTACATTGATGTGTAATAGCTTTTTGAA
CCTGATGATCTTAAAAAGCGTTTCGAGCGTGATGATGATAAAAAAATTAAAGAAGAGGAT
ATACCTGAGCGCTTATAGATTCGTATGTAGGGACGTAAAGCTCCTGATCCAGAAGAGCTC
ATGGAAGAGACAAAATGGATATCAGAAAAAATTAAGACTATAAAGGATTATAAGGGTAGC
AAGAAGTTGAATGATATTAATTTCCATTCAAAAATATTCTCTTTCCTCCAATCTCTACAT
TTGGATAAAGAAGAAGTTATGTATATCTATACATACAAGAAGAATGAATTTCATCCACAA
TTTGATCTTGAAGACTTATGGAGATTATATGACTTAGATGGCGAATGGGCTCAATTCAAT
AGACAAAAAAATCGCATTCTATTATAAATTTAATAGCTTAGAAGAGAACTTGAGAATACT
CCTCTGCTAATTTAAAATAATATAATTGATTTTGAATAAGTTAGAAAAGTTGAAGAATTT
TTCCACAAAGCCATTGATACTTAATCTCTTAAGTTTATCAAGGAATACTTTGATTACCTA
TTTATCAAAATTTATCCTTAAAAGGAGCACTAAAGATTAAAAATTCGTAAAGACCGTAAA
ACTAGAATGATTAACACTTATATTTAATGTAAGGTTCATAAGTTAGTTAGTACTTTAACT
CTTTCTCCTTAGGATCTCGTTAAAAACTTAGAAGAAATGAACTAAATTAATTAACCTCAA
TTACAACAAAATAAGCCCTAAGCCTATGCTGATAATTTAATTTCAGAAAACCCAAATGTT
CCTTGTATGAAAGAAGCTATAGAGGCTTTAGAATGCATGGTTGATTATCTATCAAATGAA
TTATTTAACTATCCTCCCCTTAAAAAATGGTATTATGAAATGTTTAAATAAAAATGCTTA
ATTTCTACTGAACCCACAGATCTTGGTAAAAAGTAAATAGATATGTTCCATCCCCTATAC
CCAGCTAAAAGAATTCATAAACGTCCTTACACTTCTTTCACTGATGACACTTGGTTGCTC
TTAGAAGAAGCTGAAAGATTGAACTTTATTACAGTTAAGATTTTCTTAAAAAGTGAAAAT
GATAATAACTCAGACAATAACAGCATATTTGATATTATGAGTAAAAATTACATGATCAGT
TTAAAAAATTTAGAAGCTCAAATTAAACAAATTAATTCTGAATGGAATTTCTTCCGTAAA
TACAACATAGAAAATGTTTGTGATAAGTTTTTCTTACCTTATGCCTAGAGCTTAGTAAGA
ATAGAACTTCATGAAAATGCTGAAAAGTGGGTTGTATCTTAATGCTAACAAAAGTTTTAC
AACATGATTAATGTTGAACCTTAGAAAAATGGTAAAATAATGTCAGTTGTCCAAGACACA
AATGGTAGAATAGGTGTTGTCTTTGTTGATGAAAATGGAATTCCTAATAATTCTATGATT
TTGAACTACTTCACCAAGAAAGAAGACTAGCTTTCAACTAAAGCCAGACTAGAAAAAACC
TAAGAAGAACATGAACTTGAAATTAAGTTTAAATCTTTTGGACCTTAATTAATTGTTGTT
GCTGCCAATAGCATAGAATCTTAAAGACTTAAAAATCTACTTCATTAAAAATATGAAAAA
TCTTAATCTTATATTTAATATGGAGATGACACAATCCCATAAATTGTGGCTAAGTAACCT
ACAATTCAAGGACCAGGAAATACCTTACAATTTAAAGATTCTGTACTCAGAGTTGCTCTT
TCATAAGGAAGAATACTTTTAAATCCTACTGCAGAAATACTCTCGCTTTGGAACGATAAT
GTTTAACAAAACGGGTGTCTTCATATCCCCCTTCATCCATCTTAAGAATATATTAGTCTT
GATAAGCTCTAGTACTCACTAGAGAAATGTTGTGTTTAAATAGTCAATTTTATGGGTGTT
GAAATGGATATGCTTTAAGATTAGCCTCACCTTAAACACCTTCTATAACACGTATGTGGT
TTAGGACCTAGAAAGGCATTAAAGCTAATTGAGCTCTTAGAAAAAAATGCTGTAATTTTT
GAAAAAGAAAAGGAAGTACCTAAAAAGAGAGGTCTATTAATTACTCAACTTGATATAAAG
GATGTTGTATTCAAGAATATTAATGGTTTCATCAGATTTAGATTTTCAAAAGACCCTATT
GAAAAGACTAGAATCAACAAAGATTTATACAAAATTGCAAAAAAGATTTGCAGAGACAGT
GCTGATAACTTCTAAATTAAAAGCTAAAGTGATGAAGATATAGTAGAATATGTTATGAAA
AATCCCAAATATATTGATGCTATGGACTTGGAAGATTATGCTTAACAGCTTGAGGAGATG
AAAAATCAACCAAACATGGCTCCTGTATTAGATTTTGTCAAAGATGAGCTTATCAACCCA
TTTAGCTATAAAAGAAATACCTATGAAGCAATTAGCGATTAAGACTTATTCTTCAAAATG
ATTAAAGAAAGTCCTCAAACATTCCGTAAAGGAATGATTGTTTCAGCAAAAATCATTCAA
ATTAGACCTAAAGAAAATCAATAAATAAAACAACACTAACTACTTGTTAAGATTGTTGAT
AACGACCTAAAATCTAGCATACTTGTTAGTGAAGAGGAATCAAAGAATTATAAGGTTGGT
GATATTATTAAAGCTTATGTTGATCAAATTTTTGTCCTTGACAACAAGCGCTCCAAGGAT
AAAATTATTGGTTTCGATGTCAATTGTGTGACTTTAACTTTTAAAGCCATCAAATTTAAT
GATTTAGTCAGAGAAATGAGATAATTTTAAGACTTAGATATTCTTAGTACTTTCAAGTTC
ATTGAAGCTGAAGACAAGCCATTGGGTATTGATGTCACTGAAAGAAAAGCTAAGAAATTC
GAACCAAGAAAGATTGCTCATCCTAATTTTAAAAATATAAGTATTACAGATGCTGTAAAG
CTTTTGAAGAATGCAAAAAATGGTGAATTTATTATTAGACCCAGTTCAAAAGGTAAACAA
TACCTTGCCATAACATGGAAATTCTTCGATGACGTGTTTGTCCACTTATCACTTAAGGAA
GAATATGGCAAAGAAAAGGGGTTCTAAACGAAATATGTTTTAAATGACAAAGAATCGTTT
GATAACTTTGATGAAATTATTGAAAGATATATCATTCCTTGCAATAATCACATGAACTCA
GCTAAAGATAATCGTAAGTTTTCAAAAAAATCAATAGAAGAAATAGAATAGGAGCTAAAG
AGAAATAAAGAAGAATAACCAGACATTATTCACTATAACTTTTGTTGTGTCCCTAAATAT
CCTCAATTTATCGTCTTGCTATATTGCTCTAAATAGGATTAAGTCACCAAAGAGTGGATT
AAAGTTAAGTATTAGGGCTTTTATTTCCATGAAAAGTATTTTGGACAATTAAAGGATTTA
ATTAAATGGTTTAAAGATTGCTTCCATACTCCCGAATACAAAAAGTATGTAAAAAAAGCT
GAAGAACCATATGCATCTAAGACCCCTAGCTCATTTAGTAATTAAGGAACTATTGGCATA
AAATAAGAAGGTGGTGTCAAATATGAAAAATCAGAGAGAGGCATTGGAGGACAAAAATGT
TAAAACTGTGGTAAATATGGTCATGCTGCTAATAACTGCAAAAATAAAAGATCCTATAAT
TCCTCTTCAGGATAGGGCAGTGCATCTGGAGCAAAACAATGTTTCCACTGTAAGGGTACT
GACCACTTTATTAAAGACTGCCCAAATAAAACTCATCAAAGCAATAAAGGAAGTGGCGGT
TTTAGCTATAGCAGAAGAGATAGAAATCAATAACACTCACGCTCTAGATCTCGTTCATAT
GACAACGAGCATTGA


>TTHERM_01093550(protein)
MSKPRKNEEVDDQMRNIGDEEEEDYQGQVEEEEDGNNQVEEDDEEEEDDDEQDDYQQDGF
VVGDSEEEEIEEEEDEDAEERRRRKKEKKRQKKLEKQNQHRRILKKGPKKRELSEDEMEN
NEIQDLEEYHEDSEEGIPDRKRNQQSRTGNDGHQGDKMDLEDQGNEDYLEDVGDYGAKYG
KTAFEELFMDDESGEEEQNENEDDENREVDDYIDVQQLFEPDDLKKRFERDDDKKIKEED
IPERLQIRMQGRKAPDPEELMEETKWISEKIKTIKDYKGSKKLNDINFHSKIFSFLQSLH
LDKEEVMYIYTYKKNEFHPQFDLEDLWRLYDLDGEWAQFNRQKNRILLQIQQLRRELENT
PLLIQNNIIDFEQVRKVEEFFHKAIDTQSLKFIKEYFDYLFIKIYPQKEHQRLKIRKDRK
TRMINTYIQCKVHKLVSTLTLSPQDLVKNLEEMNQINQPQLQQNKPQAYADNLISENPNV
PCMKEAIEALECMVDYLSNELFNYPPLKKWYYEMFKQKCLISTEPTDLGKKQIDMFHPLY
PAKRIHKRPYTSFTDDTWLLLEEAERLNFITVKIFLKSENDNNSDNNSIFDIMSKNYMIS
LKNLEAQIKQINSEWNFFRKYNIENVCDKFFLPYAQSLVRIELHENAEKWVVSQCQQKFY
NMINVEPQKNGKIMSVVQDTNGRIGVVFVDENGIPNNSMILNYFTKKEDQLSTKARLEKT
QEEHELEIKFKSFGPQLIVVAANSIESQRLKNLLHQKYEKSQSYIQYGDDTIPQIVAKQP
TIQGPGNTLQFKDSVLRVALSQGRILLNPTAEILSLWNDNVQQNGCLHIPLHPSQEYISL
DKLQYSLEKCCVQIVNFMGVEMDMLQDQPHLKHLLQHVCGLGPRKALKLIELLEKNAVIF
EKEKEVPKKRGLLITQLDIKDVVFKNINGFIRFRFSKDPIEKTRINKDLYKIAKKICRDS
ADNFQIKSQSDEDIVEYVMKNPKYIDAMDLEDYAQQLEEMKNQPNMAPVLDFVKDELINP
FSYKRNTYEAISDQDLFFKMIKESPQTFRKGMIVSAKIIQIRPKENQQIKQHQLLVKIVD
NDLKSSILVSEEESKNYKVGDIIKAYVDQIFVLDNKRSKDKIIGFDVNCVTLTFKAIKFN
DLVREMRQFQDLDILSTFKFIEAEDKPLGIDVTERKAKKFEPRKIAHPNFKNISITDAVK
LLKNAKNGEFIIRPSSKGKQYLAITWKFFDDVFVHLSLKEEYGKEKGFQTKYVLNDKESF
DNFDEIIERYIIPCNNHMNSAKDNRKFSKKSIEEIEQELKRNKEEQPDIIHYNFCCVPKY
PQFIVLLYCSKQDQVTKEWIKVKYQGFYFHEKYFGQLKDLIKWFKDCFHTPEYKKYVKKA
EEPYASKTPSSFSNQGTIGIKQEGGVKYEKSERGIGGQKCQNCGKYGHAANNCKNKRSYN
SSSGQGSASGAKQCFHCKGTDHFIKDCPNKTHQSNKGSGGFSYSRRDRNQQHSRSRSRSY
DNEH


>TTHERM_01093550(gene)
ATGAGTAAACCAAGAAAAAACGAAGAAGTTGATGATTAAATGAGAAATATTGGAGACGAA
GAAGAAGAAGATTATTAAGGGCAAGTAGAAGAAGAGGAAGATGGCAACAATCAAGTAGAA
GAGGATGATGAGGAAGAAGAAGACGATGATGAATAGGATGATTATCAATAGGATGGATTC
GTCGTTGGAGACTCTGAAGAGGAAGAAATTGAGGAAGAAGAGGATGAAGATGCCGAAGAA
AGACGTCGTCGCAAGAAAGAAAAGAAAAGATAAAAAAAATTGGAAAAATAAAATTAACAC
AGGCGTATCCTCAAGAAAGGACCTAAGAAGAGAGAACTATCAGAAGATGAAATGGAAAAT
AATGAGATATAAGATCTTGAGGAGTATCATGAAGATTCAGAAGAAGGTATTCCTGATAGA
AAGAGAAATCAGTAAAGTAGAACCGGTAATGATGGTCATTAAGGAGACAAGATGGATTTA
GAAGATTAAGGTAATGAAGATTACTTAGAAGATGTAGGTGATTATGGCGCAAAGTATGGA
AAAACAGCCTTTGAAGAACTTTTCATGGACGATGAGTCAGGAGAAGAAGAGCAAAATGAA
AACGAAGATGATGTAAATTACTTTAAGAAATTTTTTTATCTTATTTTGAAAATATAGTAA
AGCTTTTAACAAACTAAAAACAATAAATACTTCTTTTATAAAATACTTTGTATCTTATTA
TTAGGAAAATAGAGAAGTTGATGATTACATTGATGTGTAATAGCTTTTTGAACCTGATGA
TCTTAAAAAGCGTTTCGAGCGTGATGATGATAAAAAAATTAAAGAAGAGGATATACCTGA
GCGCTTATAGATTCGTATGTAGGGGTATGAAATACTTTTTTAACATATAGATATGCTTAA
TATTAAGTTTAATTATTTAATTTATCAGACGTAAAGCTCCTGATCCAGAAGAGCTCATGG
AAGAGACAAAATGGATATCAGAAAAAATTAAGACTATAAAGGATTATAAGGGTAGCAAGA
AGTTGAATGATATTAATTTCCATTCAAAAATATTCTCTTTCCTCCAATCTCTACATTTGG
ATAAAGAAGAAGTTATGTATATCTATACATACAAGAAGAATGAATTTCATCCACAATTTG
ATCTTGAAGACTTATGGAGATTATATGACTTAGATGGCGAATGGGCTCAATTCAATAGAC
AAAAAAATCGCATTCTATTATAAATTTAATAGCTTAGAAGAGAACTTGAGAATACTCCTC
TGCTAATTTAAAATAATATAATTGATTTTGAATAAGTTAGAAAAGTTGAAGAATTTTTCC
ACAAAGCCATTGATACTTAATCTCTTAAGTTTATCAAGGAATACTTTGATTACCTATTTA
TCAAAATTTATCCTTAAAAGGAGCACTAAAGATTAAAAATTCGTAAAGACCGTAAAACTA
GAATGATTAACACTTATATTTAATGTAAGGTTCATAAGTTAGTTAGTACTTTAACTCTTT
CTCCTTAGGATCTCGTTAAAAACTTAGAAGAAATGAACTAAATTAATTAACCTCAATTAC
AACAAAATAAGCCCTAAGCCTATGCTGATAATTTAATTTCAGAAAACCCAAATGTTCCTT
GTATGAAAGAAGTAATTAAAAATTTATGTTTAAAGTGATGATAAATATTAAATGTATTTT
TTATTATAAATAGGCTATAGAGGCTTTAGAATGCATGGTTGATTATCTATCAAATGAATT
ATTTAACTATCCTCCCCTTAAAAAATGGTATTATGAAATGTTTAAATAAAAATGCTTAAT
TTCTACTGAACCCACAGATCTTGGTAAAAAGTAAATAGATATGTTCCATCCCCTATACCC
AGCTAAAAGAATTCATAAACGTAAACAATTAATTTCAATAAATAGCTATATTTCTAAAGA
TAAATCAATATAATTTAACATTTAACAGGTCCTTACACTTCTTTCACTGATGACACTTGG
TTGCTCTTAGAAGAAGCTGAAAGATTGAACTTTATTACAGTTAAGATTTTCTTAAAAAGT
GAAAATGATAATAACTCAGACAATAACAGCATATTTGATATTATGAGTAAAAATTACATG
ATCAGTTTAAAAAATTTAGAAGCTCAAATTAAACAAATTAATTCTGAATGGAATTTCTTC
CGTAAATACAACATAGAAAATGTTTGTGATAAGTTTTTGTAATTCAATAAACTTTTTTCG
TTTAAATGTTTTCTAAAAAATATTTATAATAATAAAGCTTACCTTATGCCTAGAGCTTAG
TAAGAATAGAACTTCATGAAAATGCTGAAAAGTGGGTTGTATCTTAATGCTAACAAAAGT
TTTACAACATGATTAATGTTGAACCTTAGAAAAATGGTAAAATAATGTCAGTTGTCCAAG
ACACAAATGGTAGAATAGGTGTTGTCTTTGTTGATGAAGTAAAAATTAACTTATATATTT
TAATGAAAACTCGTTCTTAATACAGATTAACGAATTTTTTAAAAAAAAGAATGGAATTCC
TAATAATTCTATGATTTTGAACTACTTCACCAAGAAAGAAGACTAGCTTTCAACTAAAGC
CAGACTAGAAAAAACCTAAGAAGAACATGAACTTGAAATTAAGTTTAAATCTTTTGGACC
TTAATTAATTGTTGTTGCTGCCAATAGCATAGAATCTTAAAGACTTAAAAATCTACTTCA
TTAAAAATATGAAAAATCTTAATCTTATATTTAATATGGAGATGACACAATCCCATAAAT
TGTGGCTAAGTAACCTACAATTCAAGGACCAGGAAATACCTTACAATTTAAAGATTCTGT
ACTCAGAGTTGCTCTTTCATAAGGTAAAAATAACAAACCCTTAGATTATTAAAATAATTT
CCTAATATTTATTAAACAGGAAGAATACTTTTAAATCCTACTGCAGAAATACTCTCGCTT
TGGAACGATAATGTTTAACAAAACGGGTGTCTTCATATCCCCCTTCATCCATCTTAAGAA
TATATTAGTCTTGATAAGCTCTAGTACTCACTAGAGAAATGTTGTGTTTAAATAGTCAAT
TTTATGGGTGTTGAAATGGATATGCTTTAAGATTAGCCTCACCTTAAACACCTTCTATAA
CACGTATGTGGTTTAGGACCTAGAAAGGCATTAAAGCTAATTGAGCTCTTAGAAAAAAAT
GCTGTAATTTTTGAAAAAGAAAAGGAAGTACCTAAAAAGAGAGGTCTATTAATTACTCAA
CTTGATATAAAGGATGTTGTATTCAAGAATATTAATGGTTTCATCAGATTTAGATTTTCA
AAAGACCCTATTGAAAAGACTAGAATCAACAAAGATTGTAAAATATAAAACTTAATTTCA
AAAAAAAAATAATTCAATTTTTAAAATTTAGTATACAAAATTGCAAAAAAGATTTGCAGA
GACAGTGCTGATAACTTCTAAATTAAAAGCTAAAGTGATGAAGATATAGTAGAATATGTT
ATGAAAAATCCCAAATATATTGATGCTATGGACTTGGAAGATTATGCTTAACAGCTTGAG
GAGATGAAAAATCAACCAAACATGGCTCCTGTATTAGATTTTGTCAAAGATGAGCTTATC
AACCCATTTAGCTATAAAAGAAATACCTATGAAGCAATTAGCGATTAAGACTTATTCTTC
AAAATGATTAAAGAAAGTCCTCAAACATTCCGTAAAGGAATGATTGTTTCAGCAAAAATC
ATTCAAATTAGACCTAAAGAAAATCAATAAATAAAACAACACTAACTACTTGTTAAGATT
GTTGATAACGACCTAAAATCTAGCATACTTGTTAGTGAAGAGGAATCAAAGAATTATAAG
GTTGGTGATATTATTAAAGCTTATGTTGATCAAATTTTTGTCCTTGACAACAAGCGCTCC
AAGGATAAAATTATTGGTTTCGATGTCAATTGTGTGACTTTAACTTTTAAAGCCATCAAA
TTTAATGATTTAGTCAGAGAAATGAGATAATTTTAAGACTTAGATATTCTTAGTACTTTC
AAGGTATTCTATTTTTTACTTTTGTTAGTATAATTTAAGTTATAATAATTTAATTTTTTA
TTTAGTTCATTGAAGCTGAAGACAAGCCATTGGGTATTGATGTCACTGAAAGAAAAGCTA
AGAAATTCGAACCAAGAAAGATTGCTCATCCTAATTTTAAAAATATAAGTATTACAGATG
CTGTAAAGCTTTTGAAGAATGCAAAAAATGGTGAATTTATTATTAGACCCAGTTCAAAAG
GTAAACAATACCTTGCCATAACATGGAAATTCTTCGATGACGTGTTTGTCCACTTATCAC
TTAAGGAAGAATATGGCAAAGAAAAGGGGTTCTAAACGAAATATGTTTTAAATGACAAAG
AATCGTTTGATAACTTTGATGAAATTATTGAAAGGTAAATTAATTTATTTATATGAATTT
GTAATTTAAATATACTTACTTACTTACTTTCTATTTTAATTCCAGATATATCATTCCTTG
CAATAATCACATGAACTCAGCTAAAGATAATCGTAAGTTTTCAAAAAAATCAATAGAAGA
AATAGAATAGGAGCTAAAGAGAAATAAAGAAGAATAACCAGACATTATTCACTATAACTT
TTGTTGTGTCCCTAAATATCCTCAATTTATCGTCTTGCTATATTGCTCTAAATAGGATTA
AGTCACCAAAGAGTGGATTAAAGTTAAGTATTAGGGCTTTTATTTCCATGAAAAGTATTT
TGGACAATTAAAGGATTTAATTAAATGGTTTAAAGATTGCTTCCATACTCCCGAATACAA
AAAGTATGTAAAAAAAGCTGAAGAACCATATGCATCTAAGACCCCTAGCTCATTTAGTAA
TTAAGGAACTATTGGCATAAAATAAGAAGGTGGTGTCAAATATGAAAAATCAGAGAGAGG
CATTGGAGGACAAAGTATTTAAAATTTTTATTTATTTTTAAATTGTAAAGTTTATTTGAT
TATTTAAATCATAATTAATTTATAAATAGAATGTTAAAACTGTGGTAAATATGGTCATGC
TGCTAATAACTGCAAAAATAAAAGATCCTATAATTCCTCTTCAGGATAGGGCAGTGCATC
TGGAGCAAGTAAAATATGATTTAAAATACTTTAGATTTATTTATTTTAAAATATTTTATA
TTAAAAGAACAATGTTTCCACTGTAAGGGTACTGACCACTTTATTAAAGACTGCCCAAAT
AAAACTCATCAAAGCAATAAAGGAAGTGGCGGTTTTAGCTATAGCAGAAGAGATAGAAAT
CAATAACACTCACGCTCTAGATCTCGTTCATATGACAACGAGCATTGA