Identifiers and Description

Gene Model Identifier

TTHERM_00028580

Standard Name

SPT5 (SuPpressor of Ty's)

Aliases

PreTt14188 | 2.m02223 | 3825.m02581

Description

KOW motif family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00028580

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00759.19.997093137033517e-262KOW domain-containing protein
family protein (775 aa)
OxytrichaContig17111.0.g191.0003081162615753e-33Early transcription elongation
factor of RNA pol II, NGN sec
tion
WormBaseWBGene000050151.9994498063102785e-22locus:spt-5 Transcription el
ongation factor SPT5 status:
Confirmed UniProt:Q21338 p
rotein_id:CAA92685.1
SGDYML010W1.9994498063102785e-22SPT5 Protein involved in regul
ating Pol I and Pol II transcr
iption and pre-mRNA processing
; forms a complex with Spt4p;
contains a C-terminal repeat d
omain that is a target for pho
sphorylation by Sgv1p
DictyBaseDDB_G02876617.996041293534585e-17spt5 on chromosome: 5 position
473577 to 477073
Stentor CoeruleusSteCoe_66610.00000000003775134544279098

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88

Sequences

>TTHERM_00028580(coding)
ATGAGTGAGGATGATTTTTTAGAAGAAGATAACAACTCATATAATTATGATGATGAAGAA
GATGGTTCATATGGGGAAGAAGTTTCTAATGCTAAAAGAAAGGGCAAAACTCTGAAATAG
AATAAGAAAAAAAAATAGAAAAAAAATTAATTCTTCGAAGAAGATGCCGAAGAAAGTAAC
GGAGAAGAGGAAGAAGAAGTCAACCAGGAAAAGAGATTAAGAAATTAAGGAGATGCTAAT
TTGTATAGGTAGCGTAAAGCAAGAGATATGAGTGAAGTCATTCATGACCTCGAGCAGAGA
GGTGATTAAACTCCACCCCAAATGGATGATTTGGACTTTGATGATATAGATATGGAGCAC
ATGCCTGAAAATATCAGAAAATATGGTATCTAATAGAGAAAAGATTAAAATATTTTCAGT
GTTCCAGTCAGAAAAACCAAAGAAAAAGAAGTTGTTATTTGTCTACTAAATAAATATGCT
CAACTAAATCCTGAGCAAAATTATGGAATTTATTCTATTTCATATGTTCCTTCAGTTGAA
TCTCTAATTTATATTGAAGGTGTTAACAAAAGAGCAGTCATAAATTTCTTGGATAAATAT
CCTGACTGTAACTGCAACAAAATTGAATTAGTCAACATTGAGGAGTTTTAAGCCATATTC
GAAGACTAGGGCAAAGAGCAAGAATCATATAACGCAGAAGTTGGCTAGTTTGTTAGAATT
AGTCGTAAAGCAAGAAACTCTGACTACATCAACGATATAGGTTAGATCCACTTTATCAAA
AAGAATAATAGGGTTGTCGTCAAATTGATTCCTAGAGTTAGAATTGAGGATATGAGAAAG
AAATATGAACAAATGAATAAAAATAGTAAAAAGAGAAATCAAGATAGCTTTGTTTAAGTT
GAAGGTGATGCTGAGGACGATTAGGCAAACAAGAAGGGTAAATTCCCTTACAACAAATTT
GGAAATCAGCCTGTAGTTCCAACAAGAACAGTTGATGAAATTCTAAAGACCAGACCAGAA
TAGCAATTCTTTTCTTTAGATGAATATGAAAAAGATTGGTCAGAATGCTATAAAGCTGTT
AGTGAAGAATATAGACCAGAAAATGAGTCAACAAATCTTTTCTAACATTGTGGTTATGTT
TATAAAACATTCAATTGCAAAGACCTTATCTTCAATGAATAGCTCAAGAGTCTTGAAGAA
CTCAAAAAGTTTTATCCTCACTTAGAACTAGACGAAATTATGAATCAGAACGGCAGATTT
TTAAAAATGGCCAACAATCAAACTACTTTCGTTGTTGGAGACCCTGTTTTAATTGACAAC
ACTCTTAAGGGAAAAATCATTTCCCTTGGAAAAGAAACAGCTAAAGTTTTAATTAAAAAG
AAAAAGCTATCCATAGAAGAAGAGTATCCATTGAAATAGCTCGTTAAGTATTTTGAAGAT
GGATCAAGAGTCAAAGTAATCTCAGGTACAAGCGAAGGAATAACTGGTACGGTTTTAAGC
ACAAAAGGTGATGTGTGTGAAGTTTTTACAGATAATAATAATACTATTGAAGTTAGAACA
AAAGATCTAGCTATAACAGGTGAAGCAAGTTAAGATGCAGAAAAAATTGTAGTTAATGAA
AGTAGTGATAGAAATCTTGGCCTTAAGAAAAAAGATTTAGTGAAACTTACTGGTTTCAAT
AATGTAGGACTTATCCTTGACATCTCTAAAGATTATATTAAGATTCTAGATCAAAATGGC
AAAATCAAAAACGTCAGCTCTTTTTCCATAAACACAAAAATAGACACAAGAAAATATATT
GGTAAAAACGCAGAGGGAAATAACATCACTAATAACTCCAATATTATTATCAAGCAAGGA
TAATACTCAGGATATCAATGTTAAGTCATTCATGTCTACAAGTCATTAGTTTTCTTATTT
AATCCAAAATTCAGAGACACATACACTGTAGAAAACATAAACAACGTCTCTCTACAAACA
ACTAATCCAGTTATTTAGAGATAAGAAGCTAAAATTGCCTACGATATGAAATATGGTAAG
TAAGACAACTTAAAACCAGATGATATGAAGTAGTATGTTGGTAGACAGATGAGAATTATA
GGAGGTAAATATAAGGGATTTTAATGCACTGTTACTGATATTAGAAATGACTAAATTAAG
GTTGAGATTAACTCAAAGTTTATTACTGTCTTCATTCCTAAGTGCGATCTTATAGCTACT
GATAAAGGCTAAACAGAATTAGAGTATGGTAAGACTCCAAGCTATAACGCTCAAAGCATC
TATTAGCCAAACAATCATGAAAACATAAACTCTCCTTCTTATTATGCTAATAATTGA


>TTHERM_00028580(protein)
MSEDDFLEEDNNSYNYDDEEDGSYGEEVSNAKRKGKTLKQNKKKKQKKNQFFEEDAEESN
GEEEEEVNQEKRLRNQGDANLYRQRKARDMSEVIHDLEQRGDQTPPQMDDLDFDDIDMEH
MPENIRKYGIQQRKDQNIFSVPVRKTKEKEVVICLLNKYAQLNPEQNYGIYSISYVPSVE
SLIYIEGVNKRAVINFLDKYPDCNCNKIELVNIEEFQAIFEDQGKEQESYNAEVGQFVRI
SRKARNSDYINDIGQIHFIKKNNRVVVKLIPRVRIEDMRKKYEQMNKNSKKRNQDSFVQV
EGDAEDDQANKKGKFPYNKFGNQPVVPTRTVDEILKTRPEQQFFSLDEYEKDWSECYKAV
SEEYRPENESTNLFQHCGYVYKTFNCKDLIFNEQLKSLEELKKFYPHLELDEIMNQNGRF
LKMANNQTTFVVGDPVLIDNTLKGKIISLGKETAKVLIKKKKLSIEEEYPLKQLVKYFED
GSRVKVISGTSEGITGTVLSTKGDVCEVFTDNNNTIEVRTKDLAITGEASQDAEKIVVNE
SSDRNLGLKKKDLVKLTGFNNVGLILDISKDYIKILDQNGKIKNVSSFSINTKIDTRKYI
GKNAEGNNITNNSNIIIKQGQYSGYQCQVIHVYKSLVFLFNPKFRDTYTVENINNVSLQT
TNPVIQRQEAKIAYDMKYGKQDNLKPDDMKQYVGRQMRIIGGKYKGFQCTVTDIRNDQIK
VEINSKFITVFIPKCDLIATDKGQTELEYGKTPSYNAQSIYQPNNHENINSPSYYANN


>TTHERM_00028580(gene)
ATGAGTGAGGATGATTTTTTAGAAGAAGATAACAACTCATATAATTATGATGATGAAGAA
GATGGTTCATATGGGGTTATTATTTTTCATTCATTTAATTGTATTTAGTTCTAACTAATC
TGCAAATGATATTTATTAATGATCATAGTTAGCAAAATTCAAATTTTAATTCAAGAAAGA
AAAATTTAGTTCATCTACTTTGTCAAATGGTTCTGATTATTGAAGTTGATTTTTTAAAAA
ATAGGAAGAAGTTTCTAATGCTAAAAGAAAGGGCAAAACTCTGAAATAGAATAAGAAAAA
AAAATAGAAAAAAAATTAATTCTTCGAAGAAGATGCCGAAGAAAGTAACGGAGAAGAGGA
AGAAGAAGTCAACCAGGAAAAGAGATTAAGAAATTGTACTCAAAATTATTTAATTCTTTT
AATTTATATTAGTTTTTAGGGAAAAATAATAATAAAATAATCTAGCTAGCTAGCTTTATA
TAATAAGTCTAAGTTATGTGGGTTTTATGAATTATAAAGATAATCAAAAATTTTGAATAA
GCAGCTTCAAAAATATTGTCATAGATTATTTAATATATATAATCAAGACAAAATAAATTA
AAAAGAATTTATAAAGAGAAAATTAGAATAATTTATTTATTCATTTTCTTTTTTAGAATT
TTGTTTGAGCATAATTTTCATTATTTGTTTTCTTTAATATGAAAAGAAGGAGATGCTAAT
TTGTATAGGTAGCGTAAAGCAAGAGATATGAGTGAAGTCATTCATGACCTCGAGCAGAGA
GGTGATTAAACTCCACCCCAAATGGATGATTTGGACTTTGATGATATAGATATGGAGCAC
ATGCCTGAAAATATCAGAAAATATGGTATCTAATAGAGAAAAGATTAAAATATTTTCAGT
GTTCCAGTCAGAAAAACCAAAGAAAAAGAAGTTGTTATTTGTCTACTAAATAAATATGCT
CAACTAAATCCTGAGCAAAATTATGGAATTTATTCTATTTCATATGTTCCTTCAGTTGAA
TCTCTAATTTATATTGAAGGTGTTAACAAAAGAGCAGTCATAAATTTCTTGGATGTAATA
TATTTATTCGAACAAATAATTAATTAATTTTACAATTGGTTTATGCAATATCATCTATTA
ATTTATCTAGAAATATCCTGACTGTAACTGCAACAAAATTGAATTAGTCAACATTGAGGA
GTTTTAAGCCATATTCGAAGACTAGGGCAAAGAGCAAGAATCATATAACGCAGAAGTTGG
CTAGTTTGTTAGAATTAGTCGTAAAGCAAGAAACTCTGACTACATCAACGATATAGGTTA
GATCCACTTTATCAAAAAGAATAATAGGGTTGTCGTCAAATTGATTCCTAGAGTTAGAAT
TGAGGATATGAGAAAGAAATATGAACAAATGAATAAAAATAGTAAAAAGAGAAATCAAGA
TAGCTTTGTTTAAGTTGAAGGTGATGCTGAGGACGATTAGGCAAACAAGAAGGGTAAATT
CCCTTACAACAAATTTGGAAATCAGCCTGTAGTTCCAACAAGAACAGTTGATGAAATTCT
AAAGACCAGACCAGAATAGCAATTCTTTTCTTTAGATGAATATGAAAAAGATTGGTCAGA
ATGCTATAAAGCTGTTAGTGAAGAATATAGACCAGGTAAAAAAATTAGCAAACAGAAACA
AAAATTTAAAAAATCTATGAAATTTTTTCTAAAAATTATTTTTTTTAATTTAGAAAATGA
GTCAACAAATCTTTTCTAACATTGTGGTTATGTTTATAAAACATTCAATTGCAAAGACCT
TATCTTCAATGAATAGCTCAAGAGTCTTGAAGAACTCAAAAAGTTTTATCCTCACTTAGA
ACTAGACGAAATTATGAATCAGAACGGCAGATTTTTAAAAATGGCCAACAATCAAACTAC
TTTCGTTGTTGGAGACCCTGTTTTAATTGACAACACTCTTAAGGGAAAAATCATTTCCCT
TGGAAAAGAAACAGCTAAAGTTTTAATTAAAAAGAAAAAGCTATCCATAGAAGAAGAGTA
TCCATTGAAATAGCTCGTTAAGTATTTTGAAGATGGATCAAGAGTCAAAGTAATCTCAGG
TACAAGCGAAGGAATAGTATAAAAATTAACTTTAAAAACTAATGATTAATACTAATTTTT
ATTAATAAAATCATAAAGACTGGTACGGTTTTAAGCACAAAAGGTGATGTGTGTGAAGTT
TTTACAGATAATAATAATACTATTGAAGTTAGAACAAAAGATCTAGCTATAACAGGTGAA
GCAAGTTAAGATGCAGAAAAAATTGTAGTTAATGAAAGTAGTGATAGAAATCTTGGCCTT
AAGAAAAAAGATTTAGTGAAACTTACTGGTTTCAATAATGTAGGACTTATCCTTGACATC
TCTAAAGATTATATTAAGATTCTAGATCAAAATGGCAAAATCAAAAACGTCAGCTCTTTT
TCCATAAACACAAAAATAGACACAAGAAAATATATTGGTAAAAACGCAGAGGGAAATAAC
ATCACTAATAACTCCAATATTATTATCAAGCAAGGATAATACTCAGTAAACGAACTATTA
AATCTTAAATTTATGTCACAAATTTATTTTAATACAAATAGGGATATCAATGTTAAGTCA
TTCATGTCTACAAGTCATTAGTTTTCTTATTTAATCCAAAATTCAGAGACAGTAAAATTA
AATTTCAAAAAATTCAATAAAATTAAAATCAATAAACAACATAAAATTAGCATACACTGT
AGAAAACATAAACAACGTCTCTCTACAAACAACTAATCCAGTTATTTAGAGATAAGAAGC
TAAAATTGCCTACGATATGAAATATGGTAAGTAAGACAACTTAAAACCAGATGATATGAA
GTAGTATGTTGGTAGACAGATGAGAATTATAGGAGGTAAATATAAGGGATTTTAATGCAC
TGTTACTGATATTAGAAATGACTAAATTAAGGTTGAGATTAACTCAAAGTTTATTACTGT
CTTCATTCCTAAGTGCGATCTTATAGCTACTGATAAAGGCTAAACAGAATTAGAGTATGG
TAAGACTCCAAGCTATAACGCTCAAAGCATCTATTAGCCAAACAATCATGAAAACATAAA
CTCTCCTTCTTATTATGCTAATAATTGA