Identifiers and Description

Gene Model Identifier

TTHERM_00522580

Standard Name

SPS1 (SelenoPhosphate Synthetase )

Aliases

PreTt12373 | 65.m00191 | 3717.m00070

Description

Selenophosphate synthetase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF07813 ) LTXXQ motif
  • ( TIGR00476 ) selenide, water dikinase
  • ( TIGR01379 ) thiamine-monophosphate kinase
  • ( PF02769 ) AIR synthase related protein, C-terminal

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00522580

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12848.19.997093137033517e-262selenide, water dikinase (322
aa)
OxytrichaContig14189.0.g443.0014466598835893e-101AIR synthase related protein,
C-terminal domain
DictyBaseDDB_G02823673.000361869300436e-85selD on chromosome: 3 position
5741356 to 5742554
WormBaseWBGene000128671.0002223712504345e-79locus:seld-1 Probable seleni
de, water dikinase status:Pa
rtially_confirmed UniProt:O6
2461 protein_id:CAA16367.2

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:17821280: Harrison JA, Fowler EH (1945) AN ANTIGEN-ANTIBODY REACTION WITH TETRAHYMENA WHICH RESULTS IN DYSTOMY. Science (New York, N.Y.) 102(2638):65-6

Sequences

>TTHERM_00522580(coding)
ATGCTTAGCAAGGCTATTCCATCTTTGATAAGCAACCAATAAATTCTATCCAAAACTCTT
TCTTTCACTTAAAAATTTGTTTAAAACTTCAGTTCAGCCACTAAGATACCTAATGGAAGG
CCATAACCTAGAAAGGAATGGAATCCTGTTGAACATGGATTATCTTAAGATTTTATTGGC
AAAGGAGATATTATTTCCGAAACTCCTGATGTTAGTGTTAGACCTATTCGCAATACTAAA
AGCAAAAAGATCATTTCAACCATAGATTTCTTTTATCCAAATGTCCATGATCCCTACTTG
CAAGGTCGTATTTCGGCTTGCAACGTTTTATCTGATCTTTATAGCATGGCTGTAACAGAT
ATAGATGTAGTACTTATGGTCTTAGCTGTTTCTAACCGTATGAATGAGACAGAGAGAGAA
GTTGTTACTAGTTTGATGATTTAAGGATTTGATGAATGTGCAAATGATGCTGGAGCTTTT
GTTTTAGGAGGATAAACTATCTTTAATCCTTGGCCAATAATAGGAGGAGTTGGTATTGCA
GCGGTAGAAAGAAATGAATTCATTATGCCAAATGACGCTGTAGCTGGTGATGTAATAATT
TTAACAAAACCTTTGGGTACATAGCTTGCCGTTAATGCCATGTAGTGGTTGACAAGCTAC
AAAGACAAGTATGAAAAAATATCTAAAATACTTTCACCTGAATAAGTCAAACAAGCTTTC
AAAAAGGCTGAATATGAAATGGGAACTTTAAATATGTTTGCAGCACATTTAATGAAAAAA
TATAATGCTCATGCTTGCACTGATGTCACAGGCTTTGGAATTAAAGGGCATTCTTAATTT
TTAGCAAGTGTCTAGAAGCAAAAGGTTGATTTAGTTATTGATAATCTACCAATTATTAAA
AACATGGCAAGAATAGATAATACTGTAAAAGATTATAGATTGAAGTAAGGATTTAGTGCT
GAAACAAGTGGTGGTTTACTCATTTGTTTACCTAAATAAAATGCTAAAGACTTTATTTAG
GAGATGCATGATAATGGACTTGAGTGCAATTATGCAGGTGTTGTTGTTAATGGATCTAAT
AACTCAACTGTGTTGGAAAGCGCTACTATTGAGGATGTTTGATTTAAGTGA


>TTHERM_00522580(protein)
MLSKAIPSLISNQQILSKTLSFTQKFVQNFSSATKIPNGRPQPRKEWNPVEHGLSQDFIG
KGDIISETPDVSVRPIRNTKSKKIISTIDFFYPNVHDPYLQGRISACNVLSDLYSMAVTD
IDVVLMVLAVSNRMNETEREVVTSLMIQGFDECANDAGAFVLGGQTIFNPWPIIGGVGIA
AVERNEFIMPNDAVAGDVIILTKPLGTQLAVNAMQWLTSYKDKYEKISKILSPEQVKQAF
KKAEYEMGTLNMFAAHLMKKYNAHACTDVTGFGIKGHSQFLASVQKQKVDLVIDNLPIIK
NMARIDNTVKDYRLKQGFSAETSGGLLICLPKQNAKDFIQEMHDNGLECNYAGVVVNGSN
NSTVLESATIEDV


>TTHERM_00522580(gene)
ATGCTTAGCAAGGCTATTCCATCTTTGATAAGCAACCAATAAATTCTATCCAAAACTCTT
TCTTTCACTTAAAAATTTGTTTAAAACTTCAGTTCAGCCACTAAGATACCTAATGGAAGG
CCATAACCTAGAAAGGAATGGAATCCTGTTGAACATGGATTATCTTAAGATTTTGTTTTA
ACAAATTTCAGTGATTTAAAAGGGTGAGGATGTAAAGTGCCACAAGCCAAGCTACTTAAA
TACCTGGAAAAGATTGGCAAAGGAGATATTATTTCCGAAACTCCTGATGTTAGTGTTAGA
CCTATTCGCAATACTAAAAGCAAAAAGATCATTTCAACCATAGATTTCTTTTATCCAAAT
GTCCATGATCCCTACTTGCAAGGTCGTATTTCGGCTTGCAACGTTTTATCTGATCTTTAT
AGCATGGCTGTAACAGATATAGATGTAGTACTTATGGTCTTAGCTGTTTCTAACCGTATG
AATGAGACAGAGAGAGAAGTAAATTATTTATATTCTAAAATTAAATAAAAAGAGCCAACA
AATTTATTAATATCTTATACAAAATTGAATTTTTATAAGATTCAATATATTGAATATTTT
TTAATATTAAGGTTGTTACTAGTTTGATGATTTAAGGATTTGATGAATGTGCAAATGATG
CTGGAGCTTTTGTTTTAGGAGGATAAACTATCTTTAATCCTTGGCCAATAATAGGAGGAG
TTGGTATTGCAGCGGTAGAAAGAAATGAATTCATTATGCCAAATGACGCTGTAGCTGGTG
ATGTAATAATTTTAACAAAACCTTTGGGTACATAGCTTGCCGTTAATGCCATGTAGTGGT
TGACAAGCTACAAAGACAAGTATGAAAAAATATCTAAAATACTTTCACCTGAATAAGTCA
AACAAGCTTTCAAAAAGGCTGAATATGAAATGGGAACTTTAAATATGTTTGCAGCACATT
TAATGAAAAAATATAATGCTCATGCTTGCACTGATGTCACAGGCTTTGGAATTAAAGGGC
ATTCTTAATTTTTAGCAAGTGTCTAGAAGCAAAAGGTTGATTTAGTTATTGATAATCTAC
CAATTATTAAAAACATGGCAAGAATAGATAATACTGTAAAAGATTATAGATTGAAGTAAG
GATTTAGTGCTGAAACAAGTGGTGGTTTACTCATTTGTTTACCTAAATAAAATGCTAAAG
ACTTTATTTAGGAGATGCATGATAATGGACTTGAGTGCAATTATGCAGGTGTTGTTGTTA
ATGGATCTAATAACTCAACTGTGTTGGAAAGCGCTACTATTGAGGATGTTTGATTTAAGT
GA