Identifiers and Description

Gene Model Identifier

TTHERM_00627090

Standard Name

SPO11 (Ortholog of budding yeast SPO11)

Aliases

PreTt24634 | 88.m00102 | 3822.m00628

Description

Type IIB DNA topoisomerase family protein Required for meiotic DNA DSBs. Required for the elongation of meiotic nuclei and full chromosome pairing in Tetrahymena

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.5%

TetraMine Data

TTHERM_00627090

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17305.11.999126889527329e-167hypothetical protein (435 aa)
WormBaseWBGene000049854.998021988471165e-24locus:spo-11 Meiotic recombi
nation protein spo-11 status
:Confirmed UniProt:Q22236
protein_id:CAA92974.1
OxytrichaContig5159.0.g31.9991095569230066e-20Uncharacterized protein conser
ved in bacteria C-term(DUF2220
)
Stentor CoeruleusSteCoe_324628.533047625744066e-17
SGDYHL022C1.000361553249356e-16SPO11 Meiosis-specific protein
that initiates meiotic recomb
ination by catalyzing the form
ation of double-strand breaks
in DNA via a transesterificati
on reaction; required for homo
logous chromosome pairing and
synaptonemal complex formation

General Information

Paragraph NoGene NameParagraph Text
15SPO11Spo11p induces DSBs and at the same time triggers the elongation of meiotic nuclei (crescents) via an ATR-dependent response in Tetrahymena. The crescent resembles the conserved bouquet arrangement and the fission yeast horsetail nucleus. It promotes meiotic chromosome pairing. Thus, by nuclear elongation and the ensuing close juxtapositioning of homologous chromosome regions within the tubular nucleus, Spo11p ensures that DSBs formed by its activity can be repaired by homologous recombination.

Associated Literature

  1. Ref:20422424: Lukaszewicz A, Howard-Till RA, Novatchkova M, Mochizuki K, Loidl J (2010) MRE11 and COM1/SAE2 are required for double-strand break repair and efficient chromosome pairing during meiosis of the protist Tetrahymena. Chromosoma 119(5):505-18
  2. Ref:19297526: Loidl J, Mochizuki K (2009) Tetrahymena meiotic nuclear reorganization is induced by a checkpoint kinase-dependent response to DNA damage. Molecular biology of the cell 20(9):2428-37
  3. Ref:18522989: Mochizuki K, Novatchkova M, Loidl J (2008) DNA double-strand breaks, but not crossovers, are required for the reorganization of meiotic nuclei in Tetrahymena. Journal of cell science 121(Pt 13):2148-58

Sequences

>TTHERM_00627090(coding)
ATGAATTTCAACCAGTTAAAATCTCTAAATGCTCAAATACTCCAAAGACACTTTGAAGCT
CTCAATTTTCTTGGAATTTAATATTCAATACATGATTTAGATAAAGAAAGTATCATTAAC
AGGTTAAGAGATTTTTTCTTTTAACTTCTGAAAGAGATTATTATTTAGAATTCATGCCTT
AAACTTATGGAAAAAAAAGATATATAATTTGACTACTTTTATTTTATACATGCAGAGTAG
CAATATATCTCCAACTAATCCTTAGAAATAACTAGCTAAAAATATCAAAATTTTTACAGT
CAATTCTAATCATTAAGAAAACTTAACAAAGAAGGAAAAAATAAAACAATGGTTATCCAT
AAGAATAATTTAAAATCATTAGAAAAGTTACTTTTTTGCATAAAATAAATTTTGAATGCC
CTTAAAAATGATTTTTAAATCACAAAAAGAGAAATATTCTACACAAATGTTGAACTTTTT
GACTAAAATTAGTAAAACTTAGAAAAAATTATTCAAATATTGCAAAATTAATTAAGACTG
CCAAGAAATTGTTTAAATATTATTGCTTCAGCTAAAGGTTTAGTAACTGGTAATGTATAA
TTCTAAGTTAGTTCTTAAGCTGAATTTATTGATCTTAGTAAAAATTTTGGAGAAGTCAGG
CAAATATAGCCAAAGGAAGAAATTTTATGGATTGAAACAAACTCTGCATTTATATTGGTT
GTAGAGAAAGAAACTGTTTTTTAAAAAATCATAGCTGAAAAAGACGAATAGCTTTTGAAG
AATTGTATAATGATTACTGGGAAAGGGTATGGCGATTATAGCACCAAATAATATATAAAG
ATGCTAACTGCTAACAATCCAAACTCGCCTTTATTTTATTTAGGGGATTTCGATCCATTT
GGCTTAGATATACTCTTCAATTACACTTTTGGTTCCGAAAATTCTGTCTACTAACAAGAT
AACTTGCCAAATATTCATTTCTTAGGTCTATCAAGCTTTGATATTTTGGATTTTAATTAA
TAATCTGATGAAAAAAAATTCAATGTTGAAAACAATTTAAGCAAACAAGATATTTGTAAG
CTGGATGCCTTAATCGCCAAATTTGAATTTAATAAAATAGACTCAAATAAATTAGATGAT
CTCACTAGTTATCAGATAAATAGATGGAAGAAATGGATTGAAAATGCTGAGTTTATAAGA
CAAAACAATACAAAATATGAAATCGAAGACATTTATCCATTCCTTAGCTAAAAAAATTTA
ACTTTATCATAATTTATTATAAATAAAATCTAATCAAACAAATATTTATGA


>TTHERM_00627090(protein)
MNFNQLKSLNAQILQRHFEALNFLGIQYSIHDLDKESIINRLRDFFFQLLKEIIIQNSCL
KLMEKKDIQFDYFYFIHAEQQYISNQSLEITSQKYQNFYSQFQSLRKLNKEGKNKTMVIH
KNNLKSLEKLLFCIKQILNALKNDFQITKREIFYTNVELFDQNQQNLEKIIQILQNQLRL
PRNCLNIIASAKGLVTGNVQFQVSSQAEFIDLSKNFGEVRQIQPKEEILWIETNSAFILV
VEKETVFQKIIAEKDEQLLKNCIMITGKGYGDYSTKQYIKMLTANNPNSPLFYLGDFDPF
GLDILFNYTFGSENSVYQQDNLPNIHFLGLSSFDILDFNQQSDEKKFNVENNLSKQDICK
LDALIAKFEFNKIDSNKLDDLTSYQINRWKKWIENAEFIRQNNTKYEIEDIYPFLSQKNL
TLSQFIINKIQSNKYL


>TTHERM_00627090(gene)
AAATTTATTAATAATCTGAAAAGTACAAAAAACTTTTAAACCTAAAGAAAAATGAATTTC
AACCAGTTAAAATCTCTAAATGCTCAAATACTCCAAAGACACTTTGAAGCTCTCAATTTT
CTTGGAATTTAATATTCAATACATGATTTAGATAAAGAAAGTATCATTAACAGGTTAAGA
GATTTTTTCTTTTAACTTCTGAAAGAGATTATTATTTAGAATTCATGCCTTAAACTTATG
GAAAAAAAAGATATATAATTTGACTACTTTTATTTTATACATGCAGAGTAGCAATATATC
TCCAACTAATCCTTAGAAATAACTAGCTAAAAATATCAAAATTTTTACAGTCAATTCTAA
TCATTAAGAAAACTTAACAAAGAAGGAAAAAATAAAACAATGGTTATCCATAAGAATAAT
TTAAAATCATTAGAAAAGTTACTTTTTTGCATAAAATAAATTTTGAATGCCCTTAAAAAT
GATTTTTAAATCACAAAAAGAGAAATATTCTACACAAATGTTGAACTTTTTGACTAAAAT
TAGTAAAACTTAGAAAAAATTATTCAAATATTGCAAAATTAATTAAGACTGCCAAGAAAT
TGTTTAAATATTATTGCTTCAGCTAAAGGTTTAGTAACTGGTAATGTATAATTCTAAGTT
AGTTCTTAAGCTGAAGTAAAATTCCTTTATGTATTTCCTTGATTTAACTCACAAAAATTC
TTTAATAGTTTATTGATCTTAGTAAAAATTTTGGAGAAGTCAGGCAAATATAGCCAAAGG
AAGAAATTTTATGGATTGAAACAAACTCTGCATTTATATTGGTTGTAGAGAAAGAAACTG
TTTTTTAAAAAATCATAGCTGAAAAAGACGAGTAAGTTCCTATTAATTTATTTATTAGTT
TTATGATTTTTAATATTTTGATTTATATAATTAGATAGCTTTTGAAGAATTGTATAATGA
TTACTGGGAAAGGGTATGGCGATTATAGCACCAAATAATATATAAAGATGCTAACTGCTA
ACAATCCAAACTCGCCTTTATTTTATTTAGGGGATTTCGATCCATTTGGCTTAGATATAC
TCTTCAATTACACTTTTGGTTCCGAAAATTCTGTCTACTAACAAGATAACTTGCCAAATA
TTCATTTCTTAGGTCTATCAAGCTTTGATATTTTGGATTTTAATTAATAATCTGATGAAA
AAAAATTCAATGTTGAAAACAATTTAAGCAAACAAGATATTTGTAAGCTGGATGCCTTAA
TCGCCAAATTTGAATTTAGTAAATTGAATTAACTTAAAAATAATTATTTATAAATACCAA
AAGATAAAATAGACTCAAATAAATTAGATGATCTCACTAGTTATCAGATAAATAGATGGA
AGAAATGGATTGAAAATGCTGAGTTTATAAGACAAAACAATACAAAATATGAAATCGAAG
ACATTTATCCATTCCTTAGCTAAAAAAATTTAACTTTATCATAATTTATTATAAATAAAA
TCTAATCAAACAAATATTTATGATATTAATTTCTTATTTTTCTTTTTTGCTTGTGTAAAG
AAATATTTAGAATTAAATTTTATTTTTCACTCAAACTAAAGTTATTTTTAGTATTTTTAA
AACTGTATTTACAAATACCGTAGTTTCTTTAACCTAAATTCTCGGTTTTAAGCATACTGA
GCCAAGG