Identifiers and Description

Gene Model Identifier

TTHERM_00540050

Standard Name

SPI1 (Serine Proteinase Inhibitor 1)

Aliases

PreTt12163 | 70.m00159 | 3728.m00056

Description

proteinase inhibitor I4 serpin

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00079 ) Serpin (serine proteinase inhibitor)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 16.1%

TetraMine Data

TTHERM_00540050

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18209.19.997093137033517e-262serpin, serine protease inhibi
tor (375 aa)
WormBaseWBGene000056484.001202823045957e-54locus:srp-7 status:Confirmed
UniProt:Q6QUQ5 protein_id
:CCD68323.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00540050(coding)
ATGGAAACTCAATAAGTTAACTCTTAAATTTCTGCCTTCGGTCTCAGATTGTTCAAGGAA
CTCCCTACTAATTCTAACTTAATTTTCTCTCCTGCCTCCATTTACTTAGCTCTTGCTATG
GCTGGCTTAGGCTCTAACAGCTAAACTCTCTAAGAATTCAAGGATGTTCTTGGTTTTGAA
AACCCTCAATAGTTCGCTAAAGAAGTCAGCAACGCTACTTAGCTCTTACTTACTAAGTCT
GAAGGCATTTAAACTAGAATTGCTAACAAGATTTACTCTGGACTTCCCAACTTAAAGGCT
GAATACTAAACCATGATGAAGGAGAGCTTTAACTCACCTGTTGAATAAGTTAACTTCAAG
ACTGAATACGAATAAGTTCGTTTAACAATTAATAAGTGGGTTGAAGAAGTTACTAATGAT
AAAATCAAGGATTTACTCCAATCTGGTACTCTCACTCCCTCAACAGTCATGGTCTTAGTC
AATGCCATCTACTTTAAGGGTAACTGGGATGAATAATTCCCCAAGCACAATACTTATAAG
AGCGAATTCAACGTTTCTGCTAACTCTACCGTCTAAGTAGACTATATGTCTATTGAAAAG
AAATATCCTTATTTCGAAAATGACTCTTGCTAATACGTTTAAATTCCTTACAAAGGTAAA
GAATATATGATGGAAGTTATTTTACCTAAGGAAAGTGTTGCTTTAAGCTAGGTTGAAGGT
GATTTCAGTCAATAAGTTCTTCATGACTTAAGATAAAATGCTCATGAAACAAAGATTAAC
CTTGGTTTACCCAAATTCAAGATTGAAGATCCTTCAGCTAATAGCTTGAAGTTCATCTTA
TCCAAGCTTGGATTAAAGAAATGTTTCTAAGGTGATGCTGATTTCTCTGGTATGGATGAA
TCTAAAGAAATCTTTATTGATGACGTTGTTCACAAAGCTATGATTGAAGTTAACGAAGAA
GGAGCTGAAGCTGCTGCTGCCACCGCTATCTTAATGAGATGCTTGATGATGGAATTCAAT
CCTGAAGTAAGATGCACAAGACCTTTCCTCTACACCATCTCCCACAAGCCTACTGGCTCT
ATTCTCTTTATGGGAAGAGTCAACAACCCTGCTGAAAGCAAGTGA


>TTHERM_00540050(protein)
METQQVNSQISAFGLRLFKELPTNSNLIFSPASIYLALAMAGLGSNSQTLQEFKDVLGFE
NPQQFAKEVSNATQLLLTKSEGIQTRIANKIYSGLPNLKAEYQTMMKESFNSPVEQVNFK
TEYEQVRLTINKWVEEVTNDKIKDLLQSGTLTPSTVMVLVNAIYFKGNWDEQFPKHNTYK
SEFNVSANSTVQVDYMSIEKKYPYFENDSCQYVQIPYKGKEYMMEVILPKESVALSQVEG
DFSQQVLHDLRQNAHETKINLGLPKFKIEDPSANSLKFILSKLGLKKCFQGDADFSGMDE
SKEIFIDDVVHKAMIEVNEEGAEAAAATAILMRCLMMEFNPEVRCTRPFLYTISHKPTGS
ILFMGRVNNPAESK


>TTHERM_00540050(gene)
ATGGAAACTCAATAAGTTAACTCTTAAATTTCTGCCTTCGGTCTCAGATTGTTCAAGGAA
CTCCCTACTAATTCTAACTTAATTTTCTCTCCTGCCTCCATTTACTTAGCTCTTGCTATG
GCTGGCTTAGGCTCTAACAGCTAAACTCTCTAAGAATTCAAGGATGTTCTTGGTTTTGAA
AACCCTCAATAGTTCGCTAAAGAAGTCAGCAACGCTACTTAGCTCTTACTTACTAAGTCT
GAAGGCATTTAAACTAGAATTGCTAACAAGATTTACTCTGGACTTCCCAACTTAAAGGCT
GAATACTAAACCATGATGAAGGAGAGCTTTAACTCACCTGTTGAATAAGTTAACTTCAAG
ACTGAATACGAATAAGTTCGTTTAACAATTAATAAGTGGGTTGAAGAAGTTACTAATGAT
AAAATCAAGGATTTACTCCAATCTGGTACTCTCACTCCCTCAACAGTCATGGTCTTAGTC
AATGCCATCTACTTTAAGGGTAACTGGGATGAATAATTCCCCAAGCACAATACTTATAAG
AGCGAATTCAACGTTTCTGCTAACTCTACCGTCTAAGTAGACTATATGTCTATTGAAAAG
AAATATCCTTATTTCGAAAATGACTCTTGCTAATACGTTTAAATTCCTTACAAAGGTAAA
GAATATATGATGGAAGTTATTTTACCTAAGGAAAGTGTTGCTTTAAGCTAGGTTGAAGGT
GATTTCAGTCAATAAGTTCTTCATGACTTAAGATAAAATGCTCATGAAACAAAGATTAAC
CTTGGTTTACCCAAATTCAAGATTGAAGATCCTTCAGCTAATAGCTTGAAGTTCATCTTA
TCCAAGCTTGGATTAAAGAAATGTTTCTAAGGTGATGCTGATTTCTCTGGTATGGATGAA
TCTAAAGAAATCTTTATTGATGACGTTGTTCACAAAGCTATGATTGAAGTTAACGAAGAA
GGAGCTGAAGCTGCTGCTGCCACCGCTATCTTAATGAGATGCTTGATGATGGAATTCAAT
CCTGAAGTAAGATGCACAAGACCTTTCCTCTACACCATCTCCCACAAGCCTACTGGCTCT
ATTCTCTTTATGGGAAGAGTCAACAACCCTGCTGAAAGCAAGTGA