Identifiers and Description

Gene Model Identifier

TTHERM_00840020

Standard Name

SPA1 (homolog to human (Spartan (c1orf124))

Aliases

PreTt17817 | 146.m00118 | 3743.m00047

Description

a reader of PCNA ubiquitylation and a regulator of UV-induced DNA damage response

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF03926 ) Putative metallopeptidase (SprT family)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00840020

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19535.19.997093137033517e-262hypothetical protein (612 aa)
OxytrichaContig240.1.g1383.9989468726312675e-65SprT-like family
WormBaseWBGene000118349.998397555368434e-52locus:dvc-1 SprT-like domain
-containing protein Spartan
status:Confirmed UniProt:Q22
557 protein_id:CAA98538.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00840020(coding)
ATGAGCAAAAAAAGCGTAAATGTAGAATAATTTGACCAGAATTACTATTTCTTTTGTAAT
AGACCTGAAACTGTTGTTCCTGATTCATATGAATTATTTTTATTTTATGATGCTTACTTT
TTTTAGAATAGATTAGAAGCTTGTGAAATTAAGTGGAGCAAAAGAATGACCTCATGTGCT
GGTACTTGCAAACACTCTTCATACAATAGTTGCACAATAACTTTGAGTGAATCTTTATTG
TAATATAGAAATTCAAATGAGCTTAAAGAAACTTTATTGCATGAAATGATTCATGCATTT
TTATTTTTGACAAATCCTAAGGCATGCTTAACTGAAGGAGGACATGGTGAAGAATTTAAG
AGTTTAATGAACTTTATCAATTCAGTTACTGGATTAAATATAACAGTATATCATAGTTTT
ATAGATGAAGTAGAGTCTTTTAGAGTCCATGTTTGGAAATGCAACGGACCTTGCTAAAAT
TCACCTCCTTATTTTGGAATTTGCAAGAGATAAATGAACAGACCACCTCAAAAAAGCGAC
TTTTGGTTTGAAAGCCATTAAAAAAATTGTGGAGGGTAATTTATTAAAATAGATGGTCCA
GAATTTGGAGATGATGGAAAACCTGATCCTTCTAAACAAGCAGTAAAAAAGACAAAAAAG
GATAAAAGCGAGGAATCAAATACAAAGAGTGTTCAAAATAAAAGAAAGTAAAAGAAAAAC
GAAGCTAAAGTAGATAATTTATAATCCTTAATAAGTAGATACTTGATATCTGACACTGAA
AAAGCGAATGAAGGCTCAACAAACAAAGAATTTACATAAAAAAATTCTAATTTAGTTGAG
CAGTATAAAAAACCTTAATTTTAGGATAGTATAAGTGGAAATTACGAATTAGGAAATAAC
CTTCCAAGCTCTAATCAAATTATATTCAATTAAAATTCTTAATAATAAATAAAAAGTAAC
CCGTAATTTAAAACAATATAAAAATAGAATTCATCTAATGATGAGTTTTCTCTTGAATAG
TTTGCTTTTCATAAAAAAGGTAGGACTTAAAATAGTATTTCTAACATATATGAATTTAAC
TCAAACAATGACAATAGTAAAAACAATTTATTGTAAAATTTGACATCATTATAATAAAAT
AATTAAAAGTTTTAATAATAAGAAGAAAATATTTTATAAGGATAACAAAATAATCCAAAA
TAATTTCAATATAAAAACTATTTTGTTAAATAAAATGAAATATAATAAAAAAATAATAGT
TAAAACATTCAAATTTAAAAAAATTAAGATTCATCTGATTCCTCTCTCGAGTCTGAAGAA
AGTATGGGATTTTTATAGTAACTGATTAATAAATAGAACTCTCAATAATAAATATCATAT
AAGTTTAATGCAAATAATGTATAAATGAAAAATGATGATTTACAGCAATAGTAATAATCT
AGTTAGTTATGCTAAAATAATAGTTTAGAGGACAGCCTAGAAAAACAATTAAGTGATTAA
ATTATAGAAAATGATTAATTTCTTAGTCAGGTTAAAATACAAGTTGCTTTTTCAAGAGAC
AAATCTTTTAGCAAAGATATATATTTTATTTATTTAATTAATACTAGCTATTTTCTGATT
GATATATCTGATTTGTTGTAAAAAATATACAATTTAGATGAAAAAGTTTATTCTCTTAAA
AATGTAATATAAGAAAAAGATGGATAAGATTTTAAGATAGAAAACTACCCAAATTTTTAG
CTAAATAAATTCGATGAGAATTACCAAATTTTATTTGATTATGGAAATTTAAAAATATAT
TTTAAAGAACTAAAAAATATAAACTTGAAAACATAAAATCCCATCTCTAAAGTATTTAAA
GATGCTATTTACAAGCCTTAATTATAGCAACAGGTTAATTTATAAAACAAATGA


>TTHERM_00840020(protein)
MSKKSVNVEQFDQNYYFFCNRPETVVPDSYELFLFYDAYFFQNRLEACEIKWSKRMTSCA
GTCKHSSYNSCTITLSESLLQYRNSNELKETLLHEMIHAFLFLTNPKACLTEGGHGEEFK
SLMNFINSVTGLNITVYHSFIDEVESFRVHVWKCNGPCQNSPPYFGICKRQMNRPPQKSD
FWFESHQKNCGGQFIKIDGPEFGDDGKPDPSKQAVKKTKKDKSEESNTKSVQNKRKQKKN
EAKVDNLQSLISRYLISDTEKANEGSTNKEFTQKNSNLVEQYKKPQFQDSISGNYELGNN
LPSSNQIIFNQNSQQQIKSNPQFKTIQKQNSSNDEFSLEQFAFHKKGRTQNSISNIYEFN
SNNDNSKNNLLQNLTSLQQNNQKFQQQEENILQGQQNNPKQFQYKNYFVKQNEIQQKNNS
QNIQIQKNQDSSDSSLESEESMGFLQQLINKQNSQQQISYKFNANNVQMKNDDLQQQQQS
SQLCQNNSLEDSLEKQLSDQIIENDQFLSQVKIQVAFSRDKSFSKDIYFIYLINTSYFLI
DISDLLQKIYNLDEKVYSLKNVIQEKDGQDFKIENYPNFQLNKFDENYQILFDYGNLKIY
FKELKNINLKTQNPISKVFKDAIYKPQLQQQVNLQNK


>TTHERM_00840020(gene)
AATAGAAGAGTAAATAAATTTTTAACATCTCAAATTTTTAATCATAAAATTCAAAGAATA
TTCAATAAGAAAGTATTAATTGAAAATATTTAAAAAATAATATCTCTTTTAATGAGCAAA
AAAAGCGTAAATGTAGAATAATTTGACCAGAATTACTATTTCTTTTGTAATAGACCTGAA
ACTGTTGTTCCTGATTCATATGAATTATTTTTATTTTATGATGCTTACTTTTTTTAGAAT
AGATTAGAAGCTTGTGAAATTAAGTGGAGCAAAAGAATGACCTCATGTGCTGGTACTTGC
AAACACTCTTCATACAATAGTTGCACAATAACTTTGAGTGAATCTTTATTGTAATATAGA
AATTCAAATGAGCTTAAAGAAACTTTATTGCATGAAATGATTCATGCATTTTTATTTTTG
ACAAATCCTAAGGCATGCTTAACTGAAGGAGGACATGGTGAAGAATTTAAGAGTTTAATG
AACTTTATCAATTCAGTTACTGGATTAAATATAACAGTATATCATAGTTTTATAGATGAA
GTAGAGTCTTTTAGAGTCCATGTTTGGAAATGCAACGGACCTTGCTAAAATTCACCTCCT
TATTTTGGAATTTGCAAGAGATAAATGAACAGACCACCTCAAAAAAGCGACTTTTGGTTT
GAAAGCCATTAAAAAAATTGTGGAGGGTAATTTATTAAAATAGATGGTCCAGAATTTGGA
GATGATGGAAAACCTGATCCTTCTAAACAAGCAGTAAAAAAGACAAAAAAGGATAAAAGC
GAGGAATCAAATACAAAGAGTGTTCAAAATAAAAGAAAGTAAAAGAAAAACGAAGCTAAA
GTAGATAATTTATAATCCTTAATAAGTAGATACTTGATATCTGACACTGAAAAAGCGAAT
GAAGGCTCAACAAACAAAGAATTTACATAAAAAAATTCTAATTTAGTTGAGCAGTATAAA
AAACCTTAATTTTAGGATAGTATAAGTGGAAATTACGAATTAGGAAATAACCTTCCAAGC
TCTAATCAAATTATATTCAATTAAAATTCTTAATAATAAATAAAAAGTAACCCGTAATTT
AAAACAATATAAAAATAGAATTCATCTAATGATGAGTTTTCTCTTGAATAGTTTGCTTTT
CATAAAAAAGGTAGGACTTAAAATAGTATTTCTAACATATATGAATTTAACTCAAACAAT
GACAATAGTAAAAACAATTTATTGTAAAATTTGACATCATTATAATAAAATAATTAAAAG
TTTTAATAATAAGAAGAAAATATTTTATAAGGATAACAAAATAATCCAAAATAATTTCAA
TATAAAAACTATTTTGTTAAATAAAATGAAATATAATAAAAAAATAATAGTTAAAACATT
CAAATTTAAAAAAATTAAGATTCATCTGATTCCTCTCTCGAGTCTGAAGAAAGTATGGGA
TTTTTATAGTAACTGATTAATAAATAGAACTCTCAATAATAAATATCATATAAGTTTAAT
GCAAATAATGTATAAATGAAAAATGATGATTTACAGCAATAGTAATAATCTAGTTAGTTA
TGCTAAAATAATAGTTTAGAGGACAGCCTAGAAAAACAATTAAGTGATTAAATTATAGAA
AATGATTAATTTCTTAGTCAGGTTAAAATACAAGTTGCTTTTTCAAGAGACAAATCTTTT
AGCAAAGATATATATTTTATTTATTTAATTAATACTAGCTATTTTCTGATTGATATATCT
GATTTGTTGTAAAAAATATACAATTTAGATGAAAAAGTTTATTCTCTTAAAAATGTAATA
TAAGAAAAAGATGGATAAGATTTTAAGATAGAAAACTACCCAAATTTTTAGCTAAATAAA
TTCGATGAGAATTACCAAATTTTATTTGATTATGGAAATTTAAAAATATATTTTAAAGAA
CTAAAAAATATAAACTTGAAAACATAAAATCCCATCTCTAAAGTATTTAAAGATGCTATT
TACAAGCCTTAATTATAGCAACAGGTTAATTTATAAAACAAATGA