Identifiers and Description

Gene Model Identifier

TTHERM_00313130

Standard Name

SOR4 (Sortilin 4)

Aliases

PreTt03500 | 30.m00309 | 3810.m01921

Description

BNR/Asp-box repeat family/VPS10 domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00313130

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03334.19.997093137033517e-262BNR/Asp-box repeat family prot
ein (871 aa)
OxytrichaContig4955.0.0.g743.0001382455732556e-90BNR/Asp-box repeat
SGDYBL017C3.000969471571755e-58PEP1 Type I transmembrane sort
ing receptor for multiple vacu
olar hydrolases; cycles betwee
n the late-Golgi and prevacuol
ar endosome-like compartments
Stentor CoeruleusSteCoe_299499.221146422925876e-47
DictyBaseDDB_G02900813.998395524589391e-34sort1 on chromosome: 5 positio
n 3627939 to 3630336

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00313130(coding)
ATGAAAAAATAAGATCTGACAGTATATGTTGCAGCTTTCCTGCTTCTCTTTTCTTGTGTT
ATTCACTTTGCTAATGCTCAAGATAAAGTTAGTGAAATTTTTAAAGACAAATATGATGTC
AAATATAGAGTAACTGAATTAGATTCACCTGTTTAGGAAATTCTATGGTGCGGTAGTTCT
TAAGCAACATCTGAAGACGGAGATATTATCACCTATGATTAAACAGCAAAAGTTAGAAAA
CTTTATGTCTTAACTGATAAAGGTAAATTGTATTACTCAGAAGACTATGGCATTACATTG
AAGTTGATTAATGATGATATCCGTCAATCAACCAATTCCAAATAAACTTAGGTCGAAGTC
GATGATATCATGATCTCACCTGTTAAAAATAGAAAAGTGTTCATCTTCACTAAAAGCGGT
GAAAGCTATTATACAGAAAACTGTGGTGCCACTTATACTTCTTTCAAGCACGAGATTCTC
CTATACGATATCTAGCCCAATCCTTCTGATCACAAGTCTTTGATAGGACTTGTACCCGTT
TAGTGCTAAAAAGGAGATCCTGAGTGCTAAGGTGGTGATTCTGATTTATACTTAACAGTA
GATAGCGGTATGACTTGGAGAAAAATAGTCTCTAACGTAAATCAAGCATAGTGGGATAAG
ACCAAATAAACTCTCATGAACACATAAAATAGAATTATTTTGTCTCATTAAGAGTAAGAA
AAGAATGAAAAAGGAGAAAATGTATTCCTCAATAAAGTAAGCTACACTGATAACTATGGT
AAAGATTTAAAAGTGGTAGAAAAGAATGGAGTTAGATTCTATTAAACAGAAGAATATATT
TTTGTTTTAATCTAAGGAAAGGAATTTGGCAAATATAAACTTAATATTGGACCTTCTTTT
GTTACTCAATCTTCTAGCAGAAAAGAGATCGATTTACCTCTTTAAAGAGTTAAAGATGAA
TCTTTTACTGTCTTGGACATAGATGCAGGCTAAATTCTTATCGCTATTAATCATGAAGGT
GACAGTGCTGGATACACTAATGTTTACATTTCAAACTCCTAAGGAGAATAGTTCACTCTT
TCACTTCAATATACAGTAGGTGATGATGATTCTAACATTGATTTTGAACCCATTAACAGC
AACGAAGGAGTTTATATTGCAAACACATACACTGCAGCTTCAATTTCAAAATATCAAAAG
CTTTTGCAAAGAAAAGAAGGACAAAAATCTTCTGGATCTTCACTCACTTTGGATTCATTT
AAAATTGAAAATATGAAAAAAACTAAAATTACATTTAACAAGGGTGGTGACTGGCACGCA
ATCAAGGCTCCCGAATTCAATTATGCTGGAAATCCTATTCGTTGCTCTGGTGACTGTTCT
CTTAACTTTAAAGGAAGAACTGAGTCTCAAGGTACTCCAGTCTATTCTACTGATAATGCT
CCTGGTATTATTTTGGCTACAGGTAATGTTGGCTCTTATCTCACTAATAATCAAGATGAA
TTAAGAACTTATCTTTCTATTGATGGTGGACACACATGGAAAGAGATTCAAGTTGGATCT
CATGAATACGAAATTGGTGATTAAGGCGGTATCATCGCTATGGCTAGAGACGATAAGCTT
ACAAACGAAGTTATTTACTCTGTTGATGAAGGAGAAACATGGAGAAAATTGAATTTCAAG
GATGAAAATAAATTTAAAGTAGATAGTTTTGTTACAGAAGAAGGCAACGATGAAAGAACT
TTCTTGTTCTATGGAACCAAGACTGGTGCAGATGGAAATACTAAAGGTGTAATTGGTGCT
ATCAACTTTTCAAATTTATTCAAAAAGGAATGCACAGGATTTGAAAACCCTGGCGAAGAT
GGCAGTGATTATGAGAGATGGGTCCCATTAAACTTTGAAGGAAAAAAATGCTTATTTGGT
TCAAAAATTTCATACATAAGAAAAAAAACTGATTCTAGTTGCTTTAACAACAGAAAAGTT
GGTGATTTAAGAATGGTCTAAGGATCTTGTGAATGTACAGAAGAAGATTTCGAATGTGAT
TATGGTTTCACTAAAGATTTAATTGATGAAACAAAATGTGTTCCAATAAATGCAAAATTT
GCAAAGAAAAGAGACTAACCACCTTTGAACTGCAAAGATTTTTACTTTGTTTCTTCAGGA
AAAAGAAAAATTGCAAACAACTAATGTTAAGGCGGTATTGAAGAATTATATACAAAGAAA
AAAGTAAGATGCCCAGGAAATGAAGAAGCTCAGCAAACTTAGCAATAAACTCAAAATACT
TAAGCTAATACAGCTTAAAATAACTAGTAAGACTTATTTAGCAGAAAGCCAGAAGATATA
AAAAAAGAAATAAAAGAATAATATGGCAATTAAACAGATTAGACATCAGGAATATCCTTC
CTCGGTGTTTTGGCAGCTTTCTTAGTATTATTCTTATTATATACTTACAGGGTAGAAATA
CTTAGCAAGATAAAAGAATATCAATAAAACCAAAAGAACAAAAAGGGTGATAACAATAAA
TATGGCTATAAGCAAAAATCCTATGGAAATAATGCTGAACAGTATTCACTTTTCTAAAAT
GATCAAGACAATGATGAATACGATGCAGATATGCTTTGA


>TTHERM_00313130(protein)
MKKQDLTVYVAAFLLLFSCVIHFANAQDKVSEIFKDKYDVKYRVTELDSPVQEILWCGSS
QATSEDGDIITYDQTAKVRKLYVLTDKGKLYYSEDYGITLKLINDDIRQSTNSKQTQVEV
DDIMISPVKNRKVFIFTKSGESYYTENCGATYTSFKHEILLYDIQPNPSDHKSLIGLVPV
QCQKGDPECQGGDSDLYLTVDSGMTWRKIVSNVNQAQWDKTKQTLMNTQNRIILSHQEQE
KNEKGENVFLNKVSYTDNYGKDLKVVEKNGVRFYQTEEYIFVLIQGKEFGKYKLNIGPSF
VTQSSSRKEIDLPLQRVKDESFTVLDIDAGQILIAINHEGDSAGYTNVYISNSQGEQFTL
SLQYTVGDDDSNIDFEPINSNEGVYIANTYTAASISKYQKLLQRKEGQKSSGSSLTLDSF
KIENMKKTKITFNKGGDWHAIKAPEFNYAGNPIRCSGDCSLNFKGRTESQGTPVYSTDNA
PGIILATGNVGSYLTNNQDELRTYLSIDGGHTWKEIQVGSHEYEIGDQGGIIAMARDDKL
TNEVIYSVDEGETWRKLNFKDENKFKVDSFVTEEGNDERTFLFYGTKTGADGNTKGVIGA
INFSNLFKKECTGFENPGEDGSDYERWVPLNFEGKKCLFGSKISYIRKKTDSSCFNNRKV
GDLRMVQGSCECTEEDFECDYGFTKDLIDETKCVPINAKFAKKRDQPPLNCKDFYFVSSG
KRKIANNQCQGGIEELYTKKKVRCPGNEEAQQTQQQTQNTQANTAQNNQQDLFSRKPEDI
KKEIKEQYGNQTDQTSGISFLGVLAAFLVLFLLYTYRVEILSKIKEYQQNQKNKKGDNNK
YGYKQKSYGNNAEQYSLFQNDQDNDEYDADML


>TTHERM_00313130(gene)
ATGAAAAAATAAGATCTGACAGTATATGTTGCAGCTTTCCTGCTTCTCTTTTCTTGTGTT
ATTCACTTTGCTAATGCTCAAGATAAAGTTAGTGAAATTTTTAAAGACAAATATGATGTC
AAATATAGAGTAACTGAATTAGATTCACCTGTTTAGGAAATTCTATGGTGCGGTAGTTCT
TAAGCAACATCTGAAGACGGAGATATTATCACCTATGATTAAACAGCAAAAGTTAGAAAA
CTTTATGTCTTAACTGATAAAGGTAAATTGTATTACTCAGAAGACTATGGCATTACATTG
AAGTTGATTAATGATGATATCCGTCAATCAACCAATTCCAAATAAACTTAGGTATCCTTG
ATTTGCTATTCTTTCATTTTAAAAACAAAAATTCTCATTATTTTCTCTTTTCTTCAGATT
TTGAATTTTAATGAAATAATTTTTTTACATAAATTAAAAATTTTCATTTGTTTAATAGGT
CGAAGTCGATGATATCATGATCTCACCTGTTAAAAATAGAAAAGTGTTCATCTTCACTAA
AAGCGGTGAAAGCTATTATACAGAAAACTGTGGTGCCACTTATACTTCTTTCAAGCACGA
GATTCTCCTATACGATATCTAGCCCAATCCTTCTGATCACAAGTCTTTGATAGGACTTGT
ACCCGTTTAGTGCTAAAAAGGAGATCCTGAGTGCTAAGGTGGTGATTCTGATTTATACTT
AACAGTAGATAGCGGTATGACTTGGAGAAAAATAGTCTCTAACGTAAATCAAGCATAGTG
GGATAAGACCAAATAAACTCTCATGAACACATAAAATAGAATTATTTTGTCTCATTAAGA
GTAAGAAAAGAATGAAAAAGGAGGTAAAATAAAATAAAATATAAAATATAATTCCATTCT
ATAATTTTAAAATAAGTGTTGAAAAGAAGCAAGATTAGTTTGATTTGTTTGTTTGATATA
ATTAAAAATAAATCAATATTTACAAAAAAACTGTTAATTTAACTTTTTATAATCACTTTT
TTTAGAATTTTGTTAACATTTAATGATTTCATTAATTTCTTATTTATAAAAAAGAAAATG
TATTCCTCAATAAAGTAAGCTACACTGATAACTATGGTAAAGATTTAAAAGTGGTAGAAA
AGAATGGAGTTAGATTCTATTAAACAGAAGAATATATTTTTGTTTTAATCTAAGGAAAGG
AATTTGGCAAATATAAACTTAATATTGGACCTTCTTTTGTTACTCAATCTTCTAGCAGAA
AAGAGATCGATTTACCTCTTTAAAGAGTTAAAGATGAATCTTTTACTGTCTTGGACATAG
ATGCAGGCTAAATTCTTATCGCTATTAATCATGAAGGTGACAGTGCTGGATACACTAATG
TTTACATTTCAAACTCCTAAGGAGAATAGTTCACTCTTTCACTTCAGTAAATATTAAAAA
TCAAAATACAAATTCAACTAAAAGCAGAAGAGAACTTTATACTTTTAAAGATAAGTTAGT
AACAGCGATATAATTATTTTTTAACTAAAAGATATACAGTAGGTGATGATGATTCTAACA
TTGATTTTGAACCCATTAACAGCAACGAAGGAGTTTATATTGCAAACACATACACTGCAG
CTTCAATTTCAAAATATCAAAAGCTTTTGCAAAGAAAAGAAGGACAAAAATCTTCTGGAT
CTTCACTCACTTTGGATTCATTTAAAATTGAAAATATGAAAAAAACTAAAATTACATTTA
ACAAGGGTGGTGACTGGCACGCAATCAAGGCTCCCGAATTCAATTATGCTGGAAATCCTA
TTCGTTGCTCTGGTGACTGTTCTCTTAACTTTAAAGGAAGAACTGAGTCTCAAGGTACTC
CAGTCTATTCTACTGATAATGCTCCTGGTATTATTTTGGCTACAGGTAATGTTGGCTCTT
ATCTCACTAATAATCAAGATGAATTAAGAACTTATCTTTCTATTGATGGTGGACACACAT
GGAAAGAGGTATTTTAAAAATAAAAAAAATGCATAAAATAATTTCTATTTGGAAAATATA
AAGATTCAAGTTGGATCTCATGAATACGAAATTGGTGATTAAGGCGGTATCATCGCTATG
GCTAGAGGTATTCTATTAATTAAAAGGATAAATGAAAATTTGATATATATTTTATCTAAA
ATATAGACGATAAGCTTACAAACGAAGTTATTTACTCTGTTGATGAAGGAGAAACATGGA
GAAAATTGAATTTCAAGGATGAAAATAAATTTAAAGTAGATAGTTTTGTTACAGAAGAAG
GCAACGATGAAAGAACTTTCTTGTTCTATGGAACCAAGACTGGTGCAGATGGAAATACTA
AAGGTGTAATTGGTGCTATCAACTTTTCAAATTTATTCAAAAAGGAATGCACAGGTATAA
AAACAAACAATTTTATTTTGTAATACTTAATTTAAAAAATTTAAAGGATTTGAAAACCCT
GGCGAAGATGGCAGTGATTATGAGAGATGGGTCCCATTAAACTTTGAAGGAAAAAAATGC
TTATTTGGTTCAAAAATTTCATACATAAGAAAAAAAACTGATTCTAGTTGCTTTAACAAC
AGAAAAGTTGGTGATTTAAGAATGGTCTAAGGATCTTGTGAATGTACAGAAGAAGATTTC
GAATGTGATTATGGTTTCACTAAAGATTTAATTGATGAAACAAAATGTGTTCCAATAAAT
GCAAAATTTGCAAAGAAAAGAGACTAACCACCTTTGAACTGCAAAGATTTTTACTTTGTT
TCTTCAGGAAAAAGGTAATTAATTTTATTAATAAGTTAGCTTAATTTAAAACTCATATTA
AAAATATAGAAAAATTGCAAACAACTAATGTTAAGGCGGTATTGAAGAATTATATACAAA
GAAAAAAGTAAGATGCCCAGGAAATGAAGAAGCTCAGCAAACTTAGCAATAAACTCAAAA
TACTTAAGCTAATACAGCTTAAAATAACTAGTAAGACTTATTTAGCAGAAAGCCAGAAGA
TATAAAAAAAGAAATAAAAGAATAATATGGCAATTAAACAGATTAGACATCAGGAATATC
CTTCCTCGGTGTTTTGGCAGCTTTCTTAGTATTATTCTTATTATATACTTACAGGGTAGA
AATACTTAGCAAGATAAAAGAATATCAATAAAACCAAAAGAACAAAAAGGGTGATAACAA
TAAATATGGCTATAAGCAAAAATCCTATGGAAATAATGCTGAACAGTATTCACTTTTCTA
AAATGATCAAGACAATGATGAATACGATGCAGATATGCTTTGA