Identifiers and Description

Gene Model Identifier

TTHERM_00410210

Standard Name

SOR2 (Sortilin 2)

Aliases

PreTt21538 | 44.m00205 | 3714.m00052

Description

BNR/Asp-box repeat family/ VPS10 domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00880 ) Nebulin repeat
  • ( PF02012 ) BNR/Asp-box repeat
  • ( PF05115 ) Cytochrome B6-F complex subunit VI

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00410210

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10316.19.997093137033517e-262BNR/Asp-box repeat family prot
ein (893 aa)
OxytrichaContig4955.0.0.g743.0011595823640496e-94BNR/Asp-box repeat
Stentor CoeruleusSteCoe_299492.0842828425817514e-52
SGDYBL017C4.000521932330652e-52PEP1 Type I transmembrane sort
ing receptor for multiple vacu
olar hydrolases; cycles betwee
n the late-Golgi and prevacuol
ar endosome-like compartments
DictyBaseDDB_G02900814.000352986427571e-28sort1 on chromosome: 5 positio
n 3627939 to 3630336

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00410210(coding)
ATGAAAATAAAAAGGAATTAGCAAATTGCAATTATATTTGCTATTTTCATCTTGACTGCT
ATTTAGGCAGCAGATGATGTTGCAGATGATAAGGTTTAGTAAGCTATAAAAAGTTATTAA
AAGTAAGTAGATGGAGGTATTTTAGAATTCGAGTGGTGTGGTACAAATGAAATTTATAAC
GATGAAACTGACCGTGTTGTTGTTGATTAAGAAGTTGAAGAATCATTCGATACTCGTATA
TTTGTTCTTACAGATGAAGGTTAAGTTTTTAAAAGTACAAACTATGGTAAAAGTTGGGTC
CATGTCACTAAATCCTTTTATGGTTCAAATAATTAGCCATTTTTCTCTACTGAAGTTTCC
ATTTCTCCTGTTGATGGTAAAACAGTCTATATTTGGGGACACAAGGATACCAGCTATGTT
TCTGAGGAATGTGGTAAGACTTGGAAAAAGTTAAACCATCCTGCTGGTTTGTTTGATTTT
AGATTTCACCGTAAAAATAAAAATTGGGTATTAGCTTTCACTAATATAGAATGTAAGAGA
TTTGATGAAGATTGTGAATCTAATATGAGAAATCTTTACGTTTCTTAAGATGCGGGTGTT
ACTTTCACATTCTTAGCTACTAAAGTTTTAGAAGCTTCATGGAATAGAATGAATAACTTT
TACAACGTTGACAGTCCTGGTATTTTAATGGCCGTTCAATAAGAATCATAAAGTAATGTA
GTTTACACTGAAGACTTCGGTAAAACTATGCACACAGTTTAAGAAGGTGGTGATAATTTC
TTTTAAGCAGAGTACTTCCTCTTTTTAACAGTTAAGCCTAAAAACAGTAAAAGAACCTAT
GATATGAAAATCGCAACTATGTTTGACGATTTTAATTACTATGTTGAACCCAAAAGCTTA
AAGCTTCCCTTTGAAAACACTGATTAACTTTCGTTTACAATTCTAAAGAGCGATGGTGCC
ATGGTTTTCCTTGCCATACACCACGAAACTCAAAATATGTGGTAAAGCAATATCTATGTT
TCTGATTGGAGAGGTTATGATTTGACTTTAGCTTTACTTTACAATGTTAGAGCTCCAAAC
GGAGATTGCGACTTTGAAAAGATAGAAAGCAATGAAGGTGTTTATATAGCAAATACATAT
GATGTTGAAAAAGTTGAAAAATTAAGAAACGAAGTTAAAAAAATGGATATCAGCACTGCA
AAGAATAAATTATAAACAAAAGATAAAAAGAATTTGCACAAAGAACTAACTAATTATAGG
AAATCAGTCATTTCATTTGACAGCGGTTCTAGTTGGCATCCAATTAGAGCTCCTTCATAG
AGATGGAATGGAAAGACTGTTGTTTGCAGTGGAGAATGCAGTTTGCATTTAGCTGGTAGA
ACATATTATAAAAAATCTTAGATGTATTCTTCCTCTAACGCTCCTGGTTTAATTGTTGCA
TTAGGAAGCATTGGAACTCATCTTGAAAACAACTTCAATCTTCTTAACACATATCTTTCA
AACGATGGTGGTCACTAATGGCGTGAAATTCTTAAGGGTCCTCATATTTTTGAAATTGGT
GATCATGGTGGTATCATCGTAGCTGCTTCTGTTGCCAATAAAACAAATATCATCAAATAC
AGTTGGGATGAAGGAAAAACATGGAGCGAATATAAATTGAGTGCTTTACCATTTGAAATA
GATTAAATAATTACTGAGCCTAGCAATATGGAACAGAGATTTGTTGTTTATGGAAAAGGA
AGAAATGGAACAGAAACTTCTATGATTGTTTCTGTAGATTTATAAGATTTGCACATTAGA
GGTTGTGTAGGAGCTGAACATCCTAATAGACCTAATAGTGATTATGAAATCTGGATTCCT
ACTAATTTTAAAGGTGAACAATGTATTTTCGGTCGTAAAGTTAAATATGTTAGAAGAAAG
CCTGATGCAAAATGCTTTAATTCTATCACAACAGATTAAAAAACAGTTATTGAAGAATGC
CCATGCACATAAGAAGATTGGGAATGTGACTTCGGTTTCTACAGAAAAGAAAACGAATTA
GAATGTATTCCAATGAATGAGCATTATTCTCCTGATAATCTTGCTAAACCTCCTGCAGAT
TGTAGTTGGTCTTACTTAGTCTCAAAGGGATATAGAAAAATACCAGGAGTATTTTGTTAA
GGAGGTGTTGATTTAAGTCCAGAATATAAAGAATGTCCTCCAAAAATATCAGTGCCTAGA
ACTGAAGAAGAAACAGATTAATATAAAAGCTTCAAAGAAGCATAAAAAGAGATTATTAGC
TAATATTAATAGTAATAGTAGTAATCAAATAGTTAAAATGGAAAAACTGATTCATCATCT
TCAATAAACTGGGGTGTTATTTTTACATAAATTTTCTATGCTGGATTAATTTTAACAGCT
TTAGCTTTAGCTTTCATATTTAGAGAGAATATCAAATAAGTAGTAAAAAGCATTGGTGAA
ATAGGACATAATAAAGAACGCAAATAATATTAATAACTCTAATCATCTTAGAATAAATAA
TCATCATACACTTAATAGAAAAATACTCAAAATGTCCGCATTTAAGAAACTGAAGAAAGA
AATTATGATTTAGAAGAATAAGACATGCATTATCCAGAAGATGAAAAGCCTGTCTTGTAA
AGAGATCAAGAAGATTACTATTATTAAGAAGATTACGATTGA


>TTHERM_00410210(protein)
MKIKRNQQIAIIFAIFILTAIQAADDVADDKVQQAIKSYQKQVDGGILEFEWCGTNEIYN
DETDRVVVDQEVEESFDTRIFVLTDEGQVFKSTNYGKSWVHVTKSFYGSNNQPFFSTEVS
ISPVDGKTVYIWGHKDTSYVSEECGKTWKKLNHPAGLFDFRFHRKNKNWVLAFTNIECKR
FDEDCESNMRNLYVSQDAGVTFTFLATKVLEASWNRMNNFYNVDSPGILMAVQQESQSNV
VYTEDFGKTMHTVQEGGDNFFQAEYFLFLTVKPKNSKRTYDMKIATMFDDFNYYVEPKSL
KLPFENTDQLSFTILKSDGAMVFLAIHHETQNMWQSNIYVSDWRGYDLTLALLYNVRAPN
GDCDFEKIESNEGVYIANTYDVEKVEKLRNEVKKMDISTAKNKLQTKDKKNLHKELTNYR
KSVISFDSGSSWHPIRAPSQRWNGKTVVCSGECSLHLAGRTYYKKSQMYSSSNAPGLIVA
LGSIGTHLENNFNLLNTYLSNDGGHQWREILKGPHIFEIGDHGGIIVAASVANKTNIIKY
SWDEGKTWSEYKLSALPFEIDQIITEPSNMEQRFVVYGKGRNGTETSMIVSVDLQDLHIR
GCVGAEHPNRPNSDYEIWIPTNFKGEQCIFGRKVKYVRRKPDAKCFNSITTDQKTVIEEC
PCTQEDWECDFGFYRKENELECIPMNEHYSPDNLAKPPADCSWSYLVSKGYRKIPGVFCQ
GGVDLSPEYKECPPKISVPRTEEETDQYKSFKEAQKEIISQYQQQQQQSNSQNGKTDSSS
SINWGVIFTQIFYAGLILTALALAFIFRENIKQVVKSIGEIGHNKERKQYQQLQSSQNKQ
SSYTQQKNTQNVRIQETEERNYDLEEQDMHYPEDEKPVLQRDQEDYYYQEDYD


>TTHERM_00410210(gene)
ATGAAAATAAAAAGGAATTAGCAAATTGCAATTATATTTGCTATTTTCATCTTGACTGCT
ATTTAGGCAGCAGATGATGTTGCAGATGATAAGGTTTAGTAAGCTATAAAAAGTTATTAA
AAGTAAGTAGATGGAGGTATTTTAGAATTCGAGTGGTGTGGTACAAATGAAATTTATAAC
GATGAAACTGACCGTGTTGTTGTTGATTAAGAAGTTGAAGAATCATTCGATACTCGTATA
TTTGTTCTTACAGATGAAGGTTAAGTTTTTAAAAGTACAAACTATGGTAAAAGTTGGGTC
CATGTCACTAAATCCTTTTATGGTTCAAATGTAAAACCTCATTTTAAATTAGCATTATTT
AATTTTGAATTAACCATTTAATATCAAATTTTAAAAAAAGAATTAGCCATTTTTCTCTAC
TGAAGTTTCCATTTCTCCTGTTGATGGTAAAACAGTCTATATTTGGGGACACAAGGATAC
CAGCTATGTTTCTGAGGAATGTGGTAAGACTTGGAAAAAGTTAAACCATCCTGCTGGTTT
GTTTGATTTTAGATTTCACCGTAAAAATAAAGTAAACAAACAAACAAACAAACAAACTAC
TTAGCTATTGATCTATTTGATTTTTTAAAATGGATTTTCTTTGACTAAAGTTTATTTTTT
TATTTAATAGAATTGGGTATTAGCTTTCACTAATATAGAATGTAAGAGATTTGATGAAGA
TTGTGAATCTAATATGAGAAATCTTTACGTTTCTTAAGATGCGGGTGTTACTTTCACATT
CTTAGCTACTAAAGTTTTAGAAGCTTCATGGTACTAAATATTGTTTGTTTGATAGAGAGT
ATTTTTATAGATTATACTTTAAATATAAATAGGAATAGAATGAATAACTTTTACAACGTT
GACAGTCCTGGTATTTTAATGGCCGTTCAATAAGAATGTAAAACGTTTGAAATTTATAAT
GGAACTCTCAATAATTTTCTTTATTCAAATAAAAATAGCATAAAGTAATGTAGTTTACAC
TGAAGACTTCGGTAAAACTATGCACACAGTTTAAGAAGGTGGTGATAATTTCTTTTAAGC
AGAGTACTTCCTCTTTTTAACAGTTAAGCCTAAAAACAGTAAAAGAACCTATGATATGAA
AATCGCAACTATGTTTGACGATTTTAATTACTATGTTGAACCCAAAAGCTTAAAGCTTCC
CTTTGAAAACACTGATTAACTTTCGTTTACAATTCTAAAGAGCGATGGTGCCATGGTTTT
CCTTGCCATACACCACGAAACTCAAAATATGTGGTAAAGCAATATCTATGTTTCTGATTG
GAGAGGTTATGATTTGACTTTAGCTTTACTTTACAATGTTAGAGCTCCAAACGGAGATTG
CGACTTTGAAAAGGTAAAAAAAAATAATTTATAAAATAAGCTTAATTAATTGTTAGATAT
ATAAAAAAATATAATGACAAAAAAGTAATAGATTGAGAAATAAATAGTGATTGACTTAAA
ATAGATTCTTTCAATTTTTAGAAAATTTTTGTAGGTTAAATCAAAATTTAATAAAATATA
CAAAAAATAAAAATAGATAGAAAGCAATGAAGGTGTTTATATAGCAAATACATATGATGT
TGAAAAAGTTGAAAAATTAAGAAACGAAGTTAAAAAAATGGATATCAGCACTGCAAAGAA
TAAATTATAAACAAAAGATAAAAAGAATTTGCACAAAGAACTAACTAATTATAGGAAATC
AGTCATTTCATTTGACAGCGGTTCTAGTTGGCATCCAATTAGAGCTCCTTCATAGGTAAA
TAAAATTGCATAATATTCCAAATTAATCTATATTTTTAACTTAGAGATGGAATGGAAAGA
CTGTTGTTTGCAGTGGAGAATGCAGTTTGCATTTAGCTGGTAGAACATATTATAAAAAAT
CTTAGATGTATTCTTCCTCTAACGCTCCTGGTTTAATTGTTGCATTAGGAAGCATTGGAA
CTCATCTTGAAAACAACTTCAATCTTCTTAACACATATCTTTCAAACGATGGTGGTCACT
AATGGCGTGAAATTCTTAAGGGTCCTCATATTTTTGAAATTGGTGATCATGGTGGTATCA
TCGTAGCTGCTTCTGGTAATTTTATTTTTTATCGAACAAATTATTTATTTAAAAAGTAGA
AATAGCAAACAAATCATTAAATTTAATTATTTTAAAAAAAAATGTAAACAAAAAATAATA
ATTAATATTTTAACATTTAAAAGTTGCCAATAAAACAAATATCATCAAATACAGTTGGGA
TGAAGGAAAAACATGGAGCGAATATAAATTGAGTGCTTTACCATTTGAAATAGATTAAAT
AATTACTGAGCCTAGCAATATGGAACAGAGATTTGTTGTTTATGGAAAAGGAAGAAATGG
AACAGAAACTTCTATGATTGTTTCTGTAGATTTATAAGATTTGCACATTAGAGGTTGTGT
AGGAGCTGAACATCCTAATAGACCTAATAGTGATTATGAAATCTGGATTCCTACTAATTT
TAAAGGTGAACAATGTATTTTCGGTCGTAAAGTTAAATATGTTAGAAGAAAGCCTGATGC
AAAATGCTTTAATTCTATCACAACAGATTAAGTAATTAATTTTTTAAGGATAAAAAGTTT
ATTAAAAAACAATAAATAATAGAAAACAGTTATTGAAGAATGCCCATGCACATAAGAAGA
TTGGGAATGTGACTTCGGTTTCTACAGAAAAGAAAACGAATTAGAATGTATTCCAATGAA
TGAGCATTATTCTCCTGATAATCTTGCTAAACCTCCTGCAGATTGTAGTTGGTCTTACTT
AGTCTCAAAGGTAAAAATTAGAATTTTTTTATTAGACGTTGTTATAAGGATTCTTTAATT
TAATAGGGATATAGAAAAATACCAGGAGTATTTTGTTAAGGAGGTGTTGATTTAAGTCCA
GAATATAAAGAATGTCCTCCAAAAATATCAGTGCCTAGAACTGAAGAAGAAACAGATTAA
TATAAAAGCTTCAAAGAAGCATAAAAAGAGATTATTAGCTAATATTAATAGTAATAGTAG
TAATCAAATAGTTAAAATGGAAAAACTGATTCATCATCTTCAATAAACTGGGGTGTTATT
TTTACATAAATTTTCTATGCTGGATTAATTTTAACAGCTTTAGCTTTAGCTTTCATATTT
AGAGAGAATATCAAATAAGTAGTAAAAAGCATTGGTGAAATAGGACATAATAAAGAACGC
AAATAATATTAATAACTCTAATCATCTTAGAATAAATAATCATCATACACTTAATAGAAA
AATACTCAAAATGTCCGCATTTAAGAAACTGAAGAAAGAAATTATGATTTAGAAGAATAA
GACATGCATTATCCAGAAGATGAAAAGCCTGTCTTGTAAAGAGATCAAGAAGATTACTAT
TATTAAGAAGATTACGATTGA