Identifiers and Description

Gene Model Identifier

TTHERM_00420610

Standard Name

SOR1 (Sortilin 1 )

Aliases

PreTt07186 | 46.m00241 | 3679.m00091

Description

BNR/Asp-box repeat family/ VPS10 domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02012 ) BNR/Asp-box repeat
  • ( PF06645 ) Microsomal signal peptidase 12 kDa

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00420610

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11013.19.997093137033517e-262BNR/Asp-box repeat family prot
ein (876 aa)
OxytrichaContig4955.0.0.g742.9991470337942304e-139BNR/Asp-box repeat
Stentor CoeruleusSteCoe_299494.834541638053336e-68
SGDYJL222W7.00293386439118e-45VTH2 Putative membrane glycopr
otein with strong similarity t
o Vth1p and Pep1p/Vps10p, may
be involved in vacuolar protei
n sorting
DictyBaseDDB_G02900811.999683289470905e-41sort1 on chromosome: 5 positio
n 3627939 to 3630336

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00420610(coding)
ATGAAAGCGTACAAGCATTTATAGCTCATAGGTATTGTATTGCTTATTTCAGCTCTACAG
TTCACTGCAACAGCTAAATAGCAAGATATTTCTTTTAGCAAGAACTTTCTTGATTCTGAA
ATAGTTGATGTCATTTGGTGTGGCACCGACACATAGAATGACTAAAACGTTTTGGTTCAA
ACTGATAGTGGAACCATTTATAGATCTTAAAACAAAATGGTACACTTCGAAAATATTAGC
GATAATCTTGTTAATGCTGGTATCAAATATGTAGCTGATAATAGTTAAATAGTAGAAAGT
GAAGTTATTAGAATGATAAGAAGTCAAGCTAATCCTAATGTTATTGTTCTTTAAGGCAAA
AATGAAGTCAACTGGGTAACAAGAGACTGCGGTAATACATTTAGAGCCTTTTCAAGAAAG
AAAGATAGAATAAACACATTTAAGTTGCATCCCAGTTAAGAAGCATGGATGTTAGCAAGC
ACTAATAACGTTTGTGCCAAAAGCTAAAAAGCTCCATGCTTTTCTTTTGCTATACTATGG
TTAAGTAAAGATTTAGGAAATAGTTGGGAGAAGCTTACTCAATATGTTTACAAATTCGAA
TGGGGTAATTTAAACTTTACTAATAGCTAAGTTCCTCAACAAAGAATATTTTGGGTTTAA
GAAGATGGAAATAAGCAAAACCAAAATAGATATGGATTGCATGAAAAAAGAAACTTTTAT
TACAGCGATGACTTTTTAGCTTCAAAGAAGCTACTCATGACCAAAGGAAATGTCTTTTAC
ATTGATTATAATTACCTTTATGTTGTTCAACTTTTAGAATAAAATTCATAGCAAGTTAAC
CTAAAAGTTGCTAATCCTTAAGACTTAGATATTAAATTAAGGGATGTTTAGTTAGGCGAG
AAGCTGTAAAACCATAAGTTTACAATTTTAGATACTCGTGAAGGATAGGTTTTCTTAAAT
GTAAATCATTTAGGTTCAACATCTCCTATGGGTACTCTTTATATATCAGACTCATTAGGT
GCTCGCTTTTCCTCAAGCTTGTAGGGTCATCTTAGAAGTGAAAATGGTGATACAGATTTT
GAGCGCTTACATGGAATTTATGGAATTTATATAGCAAATGTTTATGAATAAAAAAGAAGA
GAAGAGTTTGAGAATATGTATGCAAGCGAATAAAATGATGATGATGAAAATTAAGGATAA
GACTCCAAAAATAAAAAAAGCAATACATCAATTAAATAGGATAAAAAAGCAGTAAAGATG
AAAGATTTGGTCACCCAAAAAATATAGACAATGATTACTTTCGATAAAGGTGGTATGTGG
AGTAGAATTAATGCTCCAACCACAGACTAGGAAAACAAAGAAATTAAATGTGGTGACAAC
TGCTTCTTAAATATACATTCTAATTCTAATGACTTATATAATTCATTCTACTCATCAAAA
AATGCTGTAGGTTTAGTTTTAGCAAATGGAAATGTTGGTAAGTATCTTTCACATAGTCCA
ACTCAAGTTAATACTTACCTTTCAAGAGATGCAGGTTTAACTTGGAAATAAATTAAAAGA
GGAGCTTATGTTTTCGAAATAGGTGATCATGGTTCAATAATAGTTATGGCTAAAGATAAG
GATTATGGAACCACTAAATTTATCGAATATACTTTAGATGAAGGTATTACTTGGAACCAA
GTTTAAATATCAGATACTGATATCGAAATAGATAATATAATAACAGAGCCATCAAATACT
GGAACCTCATTCATGGTTCTTGCAAAAACACTATCAACAGATAAAAAATAATATGGATTA
GCTATAACAATAGATTTTGCTAATCAGTTTAATAGAAACTGTTCTGGTGCAACAAGTCCA
GATGATCCTGATTCTGATTATGAAAAATGGATACCTCATAGCTATAAATCATCTCAATGT
CTCTTAGGTTAGAAAGTGACTTACTCACGTAAAAAACAAGAATCTGTTTGCTTAAATGGA
GAAGATTATGAAAGACAAATAGAACTTTAAGCATGTGTCTGCTCTGAAGAAGACTGGGAG
TGTGATATCGGCTATATTAGAAATGGATAAAATGGTCCATGTGTAAAGGATGGAACACTT
AGTGATGAAGAATATGAAGGAGTGATCCCAGAAATATGTACTGATTATTATTAAGTAAGT
AGAGGTTATAGAAAAATTCCTTACAATACATGCTAAGGAGGTGTAAATTATTCAGCGGAA
ACTAGAAGATGCCCTGGAAATTCAATTTTTAGCTTTAATACTTTAAAAAATTTGATTCTT
TTGATTTTAGCTATTGCAGCTATTTATTATGGAATTCAGTATAAGAGTTAACTCTCTAGC
TTGTTAATTTACTTAAGTTCTTTGATCCCTCTAATTTATTCTCATCGTAAAGATTATATT
GACTTTTCCAAAGCAAAGTCAGACCATGAAGAAAAGGAAAATAAATTTATGAATCTATTT
TCATTTAGCAACAAAAAAAATGTTAATCATTACAGCAACGTAAATGAAAGTGAAGATTAT
GAAGATAGTGAAGATCATTAACATCTTAATAACCAAAATTACAATCATTTAAATTAACAT
AACTATTTTACTGATAACCAAGATGAAGAGAGTCATTATGATTGA


>TTHERM_00420610(protein)
MKAYKHLQLIGIVLLISALQFTATAKQQDISFSKNFLDSEIVDVIWCGTDTQNDQNVLVQ
TDSGTIYRSQNKMVHFENISDNLVNAGIKYVADNSQIVESEVIRMIRSQANPNVIVLQGK
NEVNWVTRDCGNTFRAFSRKKDRINTFKLHPSQEAWMLASTNNVCAKSQKAPCFSFAILW
LSKDLGNSWEKLTQYVYKFEWGNLNFTNSQVPQQRIFWVQEDGNKQNQNRYGLHEKRNFY
YSDDFLASKKLLMTKGNVFYIDYNYLYVVQLLEQNSQQVNLKVANPQDLDIKLRDVQLGE
KLQNHKFTILDTREGQVFLNVNHLGSTSPMGTLYISDSLGARFSSSLQGHLRSENGDTDF
ERLHGIYGIYIANVYEQKRREEFENMYASEQNDDDENQGQDSKNKKSNTSIKQDKKAVKM
KDLVTQKIQTMITFDKGGMWSRINAPTTDQENKEIKCGDNCFLNIHSNSNDLYNSFYSSK
NAVGLVLANGNVGKYLSHSPTQVNTYLSRDAGLTWKQIKRGAYVFEIGDHGSIIVMAKDK
DYGTTKFIEYTLDEGITWNQVQISDTDIEIDNIITEPSNTGTSFMVLAKTLSTDKKQYGL
AITIDFANQFNRNCSGATSPDDPDSDYEKWIPHSYKSSQCLLGQKVTYSRKKQESVCLNG
EDYERQIELQACVCSEEDWECDIGYIRNGQNGPCVKDGTLSDEEYEGVIPEICTDYYQVS
RGYRKIPYNTCQGGVNYSAETRRCPGNSIFSFNTLKNLILLILAIAAIYYGIQYKSQLSS
LLIYLSSLIPLIYSHRKDYIDFSKAKSDHEEKENKFMNLFSFSNKKNVNHYSNVNESEDY
EDSEDHQHLNNQNYNHLNQHNYFTDNQDEESHYD


>TTHERM_00420610(gene)
ATGAAAGCGTACAAGCATTTATAGCTCATAGGTATTGTATTGCTTATTTCAGCTCTACAG
TTCACTGCAACAGCTAAATAGCAAGATATTTCTTTTAGCAAGAACTTTCTTGATTCTGAA
ATAGTTGATGTCATTTGGTGTGGCACCGACACATAGAATGACTAAAACGTTTTGGTTCAA
ACTGATAGTGGAACCATTTATAGATCTTAAAACAAAATGGTACACTTCGAAAATATTAGC
GATAATCTTGTTAATGCTGGTATCAAATATGTAGCTGATAATAGTTAAATAGTAAGTTTT
ACATTCAGAAAAAGGTTTTATTACATTTAACTTTATAATAATAATCAACTTAAAGGTAGA
AAGTGAAGTTATTAGAATGATAAGAAGTCAAGCTAATCCTAATGTTATTGTTCTTTAAGG
CAAAAATGAAGTCAACTGGGTAACAAGAGACTGCGGTAATACATTTAGAGCCTTTTCAAG
AAAGAAAGATAGGTAAATTTTACAAGAATTGTTAGACTAGAAATAATTTGACTGAATTTT
CTTTTTTATTTAAGAATAAACACATTTAAGTTGCATCCCAGTTAAGAAGCATGGATGTTA
GCAAGCACTAATAACGTTTGTGCCAAAAGCTAAAAAGCTCCATGCTTTTCTTTTGCTATA
CTATGGTTAAGTAAAGATTTAGGAAATAGTTGGGAGAAGCTTACTCAATATGTTTACAAA
TTCGAATGGTAAATTTCAAAATAATAAAGACAAAGCTCATCACTAATTTATTTTAAAAAT
AAAATCAATTTAGGGGTAATTTAAACTTTACTAATAGCTAAGTTCCTCAACAAAGAATAT
TTTGGGTTTAAGAAGATGGAAGTAATCTAATTTTTAAAATAAATTCAAAAATAGCAAATA
AAATTTTAATAATTAGATAAGCAAAACCAAAATAGATATGGATTGCATGAAAAAAGAAAC
TTTTATTACAGCGATGACTTTTTAGCTTCAAAGAAGCTACTCATGACCAAAGGAAATGTC
TTTTACATTGATTATAATTACCTTTATGTTGTTCAACGTAAATATTTTTATTCACAATAC
TTAGCGAATTTAAATATCTTAAAATAAATTAGTTTTAGAATAAAATTCATAGCAAGTTAA
CCTAAAAGTTGCTAATCCTTAAGACTTAGATATTAAATTAAGGGATGTTTAGTTAGGCGA
GAAGCTGTAAAACCATAAGTTTACAATTTTAGATACTCGTGAAGGATAGGTTTTCTTAAA
TGTAAATCATTTAGGTTCAACATCTCCTATGGGTACTCTTTATATATCAGACTCATTAGG
TGCTCGCTTTTCCTCAAGCTTGTAGGGTCATCTTAGAAGTGAAAATGGTGATACAGATTT
TGAGCGCTTACATGGAATTTATGGAATTTATATAGCAAATGTTTATGAATAAAAAAGAAG
AGAAGAGTTTGAGAATATGTATGCAAGCGAATAAAATGATGATGATGAAAATTAAGGATA
AGACTCCAAAAATAAAAAAAGCAATACATCAATTAAATAGGATAAAAAAGCAGTAAAGAT
GAAAGATTTGGTCACCCAAAAAATATAGACAATGATTACTTTCGATAAAGGTGGTATGTG
GAGTAGAATTAATGCTCCAACCACAGACTAGGAAAACAAAGAAATTAAATGTGGTGACAA
CTGCTTCTTAAATATACATTCTAATTCTAATGACTTATATAATTCATTCTACTCATCAAA
AAATGCTGTAGGTTTAGTTTTAGCAAATGGAAATGTTGGTAAGTATCTTTCACATAGTCC
AACTCAAGTTAATACTTACCTTTCAAGAGATGCAGGTTTAACTTGGAAATAAGTAATTTA
AAATTAAGATTTAACTTCATATTTATTTATTCTTTCAATGATTTAAAAGATTAAAAGAGG
AGCTTATGTTTTCGAAATAGGTGATCATGGTTCAATAATAGTTATGGCTAAAGATAAGGA
TTATGGAACCACTAAATTTATCGAATATACTTTAGATGAAGGTATTACTTGGAACCAAGT
TTAAATATCAGATACTGATATCGAAATAGATAATATAATAACAGAGCCATCAAATACTGG
AACCTCATTCATGGTTCTTGCAAAAACACTATCAACAGATAAAAAATAATATGGATTAGC
TATAACAATAGATTTTGCTAATCAGTTTAATAGAAACTGTTCTGGTGCAACAAGTCCAGA
TGATCCTGATTCTGATTATGAAAAATGGATACCTCATAGCTATAAATCATCTCAATGTCT
CTTAGGTTAGAAAGTGACTTACTCACGTAAAAAACAAGAATCTGTTTGCTTAAATGGAGA
AGTAAAATATTTTAGATATAAAAAAAAAAAATTAAATTAGTAAATTGTAACAAAAGGATT
ATGAAAGACAAATAGAACTTTAAGCATGTGTCTGCTCTGAAGAAGACTGGGAGTGTGATA
TCGGCTATATTAGAAATGGATAAAATGGTCCATGTGTAAAGGATGGAACACTTAGTGATG
AAGAATATGAAGGAGTGATCCCAGAAATATGTACTGATTATTATTAAGTAAGTAGAGGTT
ATAGAAAAATTCCTTACAATACATGCTAAGGAGGTGTAAATTATTCAGCGGAAACTAGAA
GATGCCCTGGAAATTCAATTTTTAGCTTTAATACTTTAAAAAATTTGATTCTTTTGATTT
TAGCTATTGCAGCTATTTATTATGGAATTCAGTATAAGAGTTAACTCTCTAGCTTGTTAA
TTTACTTAAGTTCTTTGATCCCTCTAATTTATTCTCATCGTAAAGATTATATTGACTTTT
CCAAAGCAAAGTCAGACCATGAAGAAAAGGAAAATAAATTTATGAATCTATTTTCATTTA
GCAACAAAAAAAATGTTAATCATTACAGCAACGTAAATGAAAGTGAAGATTATGAAGATA
GTGAAGATCATTAACATCTTAATAACCAAAATTACAATCATTTAAATTAACATAACTATT
TTACTGATAACCAAGATGAAGAGAGTCATTATGATTGA