Identifiers and Description

Gene Model Identifier

TTHERM_00420740

Standard Name

SNP1 (Snurportin-1)

Aliases

PreTt07199 | 46.m00254 | 3679.m00104

Description

2,2,7 trimethylguanosine (TMG) cap binding protein. TMG cap-specific (snRNP) nuclear import receptor.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01331 ) mRNA capping enzyme, catalytic domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00420740

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11004.19.997093137033517e-262hypothetical protein (524 aa)
WormBaseWBGene000177463.0007793728221555e-22status:Confirmed UniProt:O17
066 protein_id:CCD62354.1
DictyBaseDDB_G02824318.99902975825788e-19DDB_G0282431 on chromosome: 3
position 5763247 to 5764563
OxytrichaContig9791.0.g654.0002685161515803e-16mRNA capping enzyme, catalytic
domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00420740(coding)
ATGATGCAAATGGACAAGAACCGTGAGGTAATTGATGACCATAATCAATTTTTAGAGCGT
AAGCGCTAGCTTTTCAATCTTTATTAGCAAAGAAATAGAAACAGAATATTAAAAAAATCA
AGATAACTTTTCAGATTAATTAGCGAATAATAAAAGTTGGAGTAAAAAAATGAAGAGTAA
GAACTTGAAGATCTTATAGATGCTATGGATATAGAAGCAAATAATATTAAATAAAATGAA
AGCAATAATAAAACTGATGAAATAAACTAAAATTTGTAAAACAATCCTGTAATAAACGAA
GAACCTAACTCAAGAGATGATCAAAAATTCGAAAATTAAGGAAATTTTTTCGCTTAACCC
TAATTATCAAAGAGTTAGCAAAGAAAACTTGAAAGAGAGCGCAATAAATAAGAATAAAAT
TAAAAATTGGCATAATAATATAGAAAAGAAATACAAAGTTTGATGGTACAACCTTAATAC
ATGATCGAAATACCAGATGATATTGGACCAAATTATTTTGTTATGCCTCGCCCAACTGGT
AAGAGATGTCTAGTGATTACATAAAATTAATTTACTACTTCAAGAGATAAAAACGGTATT
TTAATTCACAATTTTTAGAGCATACTTCCCGGAGGCTCTAAATTGGGAGAGAAATCTAAA
TTTTACAGTATTCTAGATTGTATATTTAATGAAGAATAATAAACCTACTATATTATGGAT
GTAATTATATACAAAGATTTGAATATGGCAGAAAATTCAACCGATATGAGATTCTTTTGG
ATTCAATAAAAATTCAGTCAAAACGAATTTCAAGATATTTCTGACTGCAATTAATTTAAA
TTCAAGATAGTACCAAAGTAGATCTGCACTCGCTCATCTTTTAAGGAAGTATATCAATGC
AAATTCGACTTCTAAAAAGACGGAATTCTGTTTATTCATAAAGACACTGATTACAAAGGG
GGAATTCATCCTAATTTTTTATTTTGGAAGGACACAAATTTTGAAAATTCACCTTTCAAA
AAAATTCCTCTTTCAATTACTTCCTCAGAATAAAATGCTCTTCCAAAAGTAACTGCACAT
TTAATTTGTGATGAGAACTACTGCTTGGGCACTTTAGATAACTATATTCTCTATTAGCTT
AGCTCAGAGGAAAGAAAAATCTATGGAGTTTAACCTTATATGATTGTGAAGGTAGAAATT
AGTACTATAAAATTAACACCTTTCTAAACTCAACTACTTTAGGAATTCGAATCATACCCA
CATGAAATTGAGCCTCAAAAAAAAGATTCAAATGCAATCGAAGAAGAAATTAAGCTAAAA
AAGAATTGGGTCTTTGTAGAAGATTTAAATATTATTGAAGTTATTGATCCAAATTAAATT
TATGCATCAGCAAACAACAAAGATTCTTCATCACAGCAAATTAATGAAGAAGTTGATAAC
CTAAATTTATGTCCTGACTCCTTATCACAATTAGTCTTTGAGTACAAGCTCATTACCAAT
CCCATAAGTTTTTCATAAATATGTGAAAGAATAGATATAGAATTAGAAAGTTCAGATGAG
CAATGA


>TTHERM_00420740(protein)
MMQMDKNREVIDDHNQFLERKRQLFNLYQQRNRNRILKKSRQLFRLISEQQKLEQKNEEQ
ELEDLIDAMDIEANNIKQNESNNKTDEINQNLQNNPVINEEPNSRDDQKFENQGNFFAQP
QLSKSQQRKLERERNKQEQNQKLAQQYRKEIQSLMVQPQYMIEIPDDIGPNYFVMPRPTG
KRCLVITQNQFTTSRDKNGILIHNFQSILPGGSKLGEKSKFYSILDCIFNEEQQTYYIMD
VIIYKDLNMAENSTDMRFFWIQQKFSQNEFQDISDCNQFKFKIVPKQICTRSSFKEVYQC
KFDFQKDGILFIHKDTDYKGGIHPNFLFWKDTNFENSPFKKIPLSITSSEQNALPKVTAH
LICDENYCLGTLDNYILYQLSSEERKIYGVQPYMIVKVEISTIKLTPFQTQLLQEFESYP
HEIEPQKKDSNAIEEEIKLKKNWVFVEDLNIIEVIDPNQIYASANNKDSSSQQINEEVDN
LNLCPDSLSQLVFEYKLITNPISFSQICERIDIELESSDEQ


>TTHERM_00420740(gene)
ATGATGCAAATGGACAAGAACCGTGAGGTAATTGATGACCATAATCAATTTTTAGAGCGT
AAGCGCTAGCTTTTCAATCTTTATTAGCAAAGAAATAGAAACAGAATATTAAAAAAATCA
AGATAACTTTTCAGATTAATTAGCGAATAATAAAAGTTGGAGTAAAAAAATGAAGAGTAA
GAACTTGAAGATCTTATAGATGCTATGGATATAGAAGCAAATAATATTAAATAAAATGAA
AGCAATAATAAAACTGATGAAATAAACTAAAATTTGTAAAACAATCCTGTAATAAACGAA
GAACCTAACTCAAGAGATGATCAAAAATTCGAAAATTAAGGAAATTTTTTCGCTTAACCC
TAATTATCAAAGAGTTAGCAAAGAAAACTTGAAAGAGAGCGCAATAAATAAGAATAAAAT
TAAAAATTGGCATAATAATATAGAAAAGAAATACAAAGTTTGATGGTACAACCTTAATAC
ATGATCGAAATACCAGATGATATTGGACCAAATTATTTTGTTATGCCTCGCCCAACTGGT
AAGAGATGTCTAGTGATTACATAAAATTAATTTACTACTTCAAGAGATAAAAACGGTATT
TTAATTCACAATTTTTAGAGCATACTTCCCGGAGGCTCTAAATTGGGAGAGAAATCTAAA
TTTTACAGTATTCTAGATTGTATATTTAATGAAGAATAATAAACCTACTATATTATGGAT
GTAATTATATACAAAGATTTGAATATGGCAGAAAATTCAACCGATATGAGATTCTTTTGG
ATTCAATAAAAATTCAGTCAAAACGAATTTCAAGATATTTCTGACTGCAATTAATTTAAA
TTCAAGATAGTACCAAAGTAGATCTGCACTCGCTCATCTTTTAAGGAAGTATATCAATGC
AAATTCGACTTCTAAAAAGACGGAATTCTGTTTATTCATAAAGACACTGATTACAAAGGG
GGAATTCATCCTAATTTTTTATTTTGGAAGGACACAAATTTTGAAAATTCACCTTTCAAA
AAAATTCCTCTTTCAATTACTTCCTCAGAATAAAATGCTCTTCCAAAAGTAACTGCACAT
TTAATTTGTGATGAGAACTACTGCTTGGGCACTTTAGATAACTATATTCTCTATTAGCTT
AGCTCAGAGGAAAGAAAAATCTATGGAGTTTAACCTTATATGATTGTGAAGGTAGAAATT
AGTACTATAAAATTAACACCTTTCTAAACTCAACTACTTTAGGAATTCGAATCATACCCA
CATGAAATTGAGCCTCAAAAAAAAGATTCAAATGCAATCGAAGAAGAAATTAAGCTAAAA
AAGAATTGGGTCTTTGTAGAAGATTTAAATATTATTGAAGTTATTGATCCAAATTAAATT
TATGCATCAGCAAACAACAAAGATTCTTCATCACAGCAAATTAATGAAGAAGTTGATAAC
CTAAATTTATGTCCTGACTCCTTATCACAATTAGTCTTTGAGTACAAGCTCATTACCAAT
CCCATAAGTTTTTCATAAATATGTGAAAGAATAGATATAGAATTAGAAAGTTCAGATGAG
CAATGA