Identifiers and Description

Gene Model Identifier

TTHERM_00433640

Standard Name

SNML1 (Sensitive to Nitrogen Mustard 1 nuclease-like protein 1)

Aliases

PreTt26505 | 48.m00268 | 3831.m01604

Description

beta-lactamase superfamily protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00433640

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04201.19.997093137033517e-262hypothetical protein (525 aa)
OxytrichaContig13766.0.g889.997441244797434e-45DNA repair metallo-beta-lactam
ase
DictyBaseDDB_G02777551.0002124404074584e-26dclre1 on chromosome: 2 positi
on 8451915 to 8454935
Stentor CoeruleusSteCoe_288131.4251640827409352e-21
SGDYMR137C1.000116773704384e-19PSO2 Nuclease required for a p
ost-incision step in the repai
r of DNA single and double-str
and breaks that result from in
terstrand crosslinks produced
by a variety of mono- and bi-f
unctional psoralen derivatives
; induced by UV-irradiation
WormBaseWBGene000452377.003160085026828e-16locus:mrt-1 status:Confirmed
UniProt:Q8T3E0 protein_id
:CAD30439.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00433640(coding)
ATGAGATGCATCACAAACACAAATATAATTGTTGATGATTTTGATTTTTGTAAAAATTTT
AAGAAAAACACTTTTATACATTTTTTGACTCATTTTCATCAGGACCATTATGAAGGCTTA
AGTCCTCTCTGGGATTACTCCCCAATTTATTGCTCTGAAATATCAAAAAACTTAATTTTA
CAAAAATATCCAAAGATATAAAATATTCATGCTCTTCAGCTGAATACAAAGTATGAGTTT
ACCTTAAACAACATAGAGAGTTTAAAAGTTGAAGTTTGGTTCTTCGATGCTCACCATATT
CCTGGGTCTGTTATGATTCTATTTAAAGGTTATATGGGAACTATTTTTCATACTGGAGAT
TTTCGGTTTAATTAATCCATGATTGACTGCAATCCGATTCTGTTTCCTCCTGAATTAAGG
ACCAAAAATCTCCAAAACTGTTCAATTTAAATAGATGAAATGATTTATGACAACACTTAC
TGCAATCCTGCATTCAATTTTCCTAGAGGAGATGAGGTCTTTAAAAGAATGGTTGAAATA
ATAGAAAAGAATAGAAATAAAAGAGTTTTAATAGCAATGGGAGCACTAGGAAAAGAAGAC
ATTTGCATAAAATTATCAGAATATTTTCAAACACTGTTGATAATTGGTGAATCGAAGCTA
CTTTAATTGGAGGCTATAGGGACATACAGGACAGATATTTTTACTACAGATAGAGATTAG
GGTTTTATTGAGATAATAAAAAAAAGACACAGAGAGCAAAAAATATAAGAATTTAAAAGC
CTAAATTATGATTTTATTGTGATTACTACAGACTTTCTAATGTTGGATCATAAAGATCCA
GATGGGATCAATTATATGGTCCCATACAGTCTTCATTCTAACTTTAAAGAAATGGAGTGT
TTAGTAAAGGCAATTTCACCATCAATTTTACGGAGACTAGTTTTAGAAATATATAAATTG
CCTCAGTTTAGAAAAAACCAGGTGATTGACAATATTAAATTCTACTTGAGTTATGTAAAT
GGACTTAAAAGAAAAGGAGAAGGTGGTTACTCATAGTTCAAATAGAAATATACCAGACTG
CATAAGCTAAGTGATGACTTCAGAAGGTGGATGAACCCTGAATCCTAATAAGAGCTCATG
AGCTTCTTAGGTTTGGATGTTGAACCTGATAGAAACCTAAGAAAATATAAAAGAAAAGAA
ATATCAGAAGAGGAATAAGCTAAGCTGGATTTTATATACCAAAACAATCTTCTTAAGCTA
GAAAAAAAGGAATCTCTCTTTGATATTTCAGATAGACTTAAAAGCACGAATAATAACAAA
AGAATAGACCACTTTTTTAGTTCCTAGCAAAACTCATAACAACTCTAAAAGTCTAAAAAA
TTTGATAGCCGCCAATCAGTTAACTCATAAAGTTCTTGTAAAATTGATATTCTAGAAGAC
CCTACTTTGAAGAGTCTTTTTGATTAGTTTTTGAATTCTCAAACGAATTTAAGCTTTATG
AGCCATAAAGGTGATTAAATCAATAATTAAGTTCAGCAAGAGAACCAATAAGAAAAATAA
AATTGA


>TTHERM_00433640(protein)
MRCITNTNIIVDDFDFCKNFKKNTFIHFLTHFHQDHYEGLSPLWDYSPIYCSEISKNLIL
QKYPKIQNIHALQLNTKYEFTLNNIESLKVEVWFFDAHHIPGSVMILFKGYMGTIFHTGD
FRFNQSMIDCNPILFPPELRTKNLQNCSIQIDEMIYDNTYCNPAFNFPRGDEVFKRMVEI
IEKNRNKRVLIAMGALGKEDICIKLSEYFQTLLIIGESKLLQLEAIGTYRTDIFTTDRDQ
GFIEIIKKRHREQKIQEFKSLNYDFIVITTDFLMLDHKDPDGINYMVPYSLHSNFKEMEC
LVKAISPSILRRLVLEIYKLPQFRKNQVIDNIKFYLSYVNGLKRKGEGGYSQFKQKYTRL
HKLSDDFRRWMNPESQQELMSFLGLDVEPDRNLRKYKRKEISEEEQAKLDFIYQNNLLKL
EKKESLFDISDRLKSTNNNKRIDHFFSSQQNSQQLQKSKKFDSRQSVNSQSSCKIDILED
PTLKSLFDQFLNSQTNLSFMSHKGDQINNQVQQENQQEKQN


>TTHERM_00433640(gene)
ATGAGATGCATCACAAACACAAATATAATTGTTGATGATTTTGATTTTTGTAAAAATTTT
AAGAAAAACACTTTTATACATTTTTTGACTCATTTTCATCAGGACCATTATGAAGGCTTA
AGTCCTCTCTGGGATTACTCCCCAATTTATTGCTCTGAAATATCAAAAAACTTAATTTTA
CAAAAATATCCAAAGATATAAAATATTCATGCTCTTCAGCTGAATACAAAGTATGAGTTT
ACCTTAAACAACATAGAGAGTTTAAAAGTTGAAGTTTGGTTCTTCGATGCTCACCATATT
CCTGGGTCTGTTATGATTCTATTTAAAGGTTATATGGGAACTATTTTTCATACTGGAGAT
TTTCGGTTTAATTAATCCATGATTGACTGCAATCCGATTCTGTTTCCTCCTGAATTAAGG
ACCAAAAATCTCCAAAACTGTTCAATTTAAGTAAATTTTTATAGAAATTTAATTAGCATA
TCGAAAATCTTTTGTTTAAACCAGATAGATGAAATGATTTATGACAACACTTACTGCAAT
CCTGCATTCAATTTTCCTAGAGGAGATGAGGTCTTTAAAAGAATGGTTGAAATAATAGAA
AAGAATAGAAATAAAAGAGTTTTAATAGCAATGGGAGCACTAGGAAAAGAAGACATTTGC
ATAAAATTATCAGAATATTTTCAAACACTGTTGATAATTGGTGAATCGAAGGTAAATAGA
TATTTTTTTTATATATTTTTAGCAAATTTGATTTAACTTATTTATGCTCTACTTTTACAA
AAAAAAGCTACTTTAATTGGAGGCTATAGGGACATACAGGACAGATATTTTTACTACAGA
TAGAGATTAGGGTTTTATTGAGATAATAAAAAAAAGACACAGAGAGCAAAAAATATAAGA
ATTTAAAAGCCTAAATTATGATTTTATTGTGATTACTACAGACTTTCTAATGTTGGATCA
TAAAGATCCAGATGGGATCAATTATATGGTCCCATACAGTCTTCATTCTAACTTTAAAGA
AATGGAGTGTTTAGTAAAGGCAATTTCACCATCAATTTTACGGAGACTAGTTTTAGAAAT
ATATAAATTGCCTCAGTTTAGAAAAAACCAGGTGATTGACAATATTAAATTCTACTTGAG
TTATGTAAATGGACTTAAAAGAAAAGGAGAAGGTGGTTACTCATAGTTCAAATAGAAATA
TACCAGACTGCATAAGCTAAGTGATGACTTCAGAAGGTGGATGAACCCTGAATCCTAATA
AGAGCTCATGAGCTTCTTAGGTTTGGATGTTGAACCTGATAGAAACCTAAGAAAATATAA
AAGAAAAGAAATATCAGAAGAGGAATAAGCTAAGCTGGATTTTATATACCAAAACAATCT
TCTTAAGCTAGAAAAAAAGGAATCTCTCTTTGATATTTCAGATAGACTTAAAAGCACGAA
TAATAACAAAAGAATAGACCACTTTTTTAGTTCCTAGCAAAACTCATAACAACTCTAAAA
GTCTAAAAAATTTGATAGCCGCCAATCAGTTAACTCATAAAGTTCTTGTAAAATTGATAT
TCTAGAAGACCCTACTTTGAAGAGTCTTTTTGATTAGTTTTTGAATTCTCAAACGAATTT
AAGCTTTATGAGCCATAAAGGTGATTAAATCAATAATTAAGTTCAGCAAGAGAACCAATA
AGAAAAATAAAATTGA